CAZyme Information: sr16738-t26_1-p1

Basic Information

• Species: Sporisorium reilianum
• Lineage: Basidiomycota; Ustilaginomycetes; ; Ustilaginaceae; Sporisorium; Sporisorium reilianum
• CAZyme ID: sr16738-t26_1-p1
• CAZy Family: GT4
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
462	FQ311443|CGC2	49826.79	7.5856

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SreilianumSRZ2	6791	999809	118	6673

• Gene Location: location=FQ311443:361167-362555(+)

Full Sequence      

MKVPTANLLSAALPLLNSTLRENCFVPSNEVISAPQISLPLHKADAKPIVTSWPAQPLTD
EECIVKPLGWGRDDSSQIQEAVLRCGNGGTITLPSPYTYTISNRMYTKLNRARLNIHGLP
SFTPDLGYWIGESHRVGFQNMSTAWIVEGNDYHISGGGWQQGGILGNGQAWYGRAAGQSN
QYGRPISLSLYNSTNATIDHFSFYQPQFWSLWVQDSRNVHINNIFINGSNTDPAGNSSNY
ATNIDGIDTMRVDGLHLHNWNFRGGDDCFAPKGNTTNVVLRNFTCVGGGIAFGSVGQYPG
SPDYITNVSVSDIKVVGEVSPLYGGATPAGGAYFKSWVGVSMGAPPQGGGGTGRVSNITF
NNMKVKNTTQSVFINKCYCKVKDQANFCDTSTFQFDDLQFNNISGMVRSADGINLNCSAV
APCHNISFNLVNLTSQLTNKTAAAVLTNTVNVTGVTNKTMTS

Enzyme Prediction     

No EC number prediction in sr16738-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	81	448	9.2e-56	0.963076923076923

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	2.43e-24	153	435	52	305	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
177865	PLN02218	3.25e-23	69	445	77	420	polygalacturonase ADPG
215426	PLN02793	1.90e-17	162	435	151	396	Probable polygalacturonase
215120	PLN02188	6.38e-17	155	448	111	389	polygalacturonase/glycoside hydrolase family protein
178580	PLN03003	1.24e-13	162	426	121	350	Probable polygalacturonase At3g15720

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBQ71390.1|GH28	0.0	1	462	1	462
SJX66415.1|GH28	0.0	1	462	1	463
CDU24359.1|GH28	5.27e-313	1	462	1	463
UJO21503.1|GH28	4.04e-138	105	448	1	344
BCR93142.1|GH28	3.72e-99	63	433	32	413

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C2L_A	7.41e-20	73	423	30	351	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QBB4|RGXA_ASPNC	2.63e-99	63	434	32	414	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxA PE=2 SV=2
sp|B8NJB0|RGXA_ASPFN	1.01e-98	61	433	29	412	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=rgxA PE=3 SV=2
sp|Q2UP32|RGXA_ASPOR	1.01e-98	61	433	29	412	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=rgxA PE=3 SV=1
sp|Q2EQQ2|RGXA_ASPNG	1.05e-98	63	434	32	414	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger OX=5061 GN=rgxA PE=2 SV=1
sp|A2RAY7|RGXC_ASPNC	3.37e-57	63	431	30	393	Putative galacturan 1,4-alpha-galacturonidase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxC PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000050	0.000001

TMHMM  Annotations     

There is no transmembrane helices in sr16738-t26_1-p1.