CAZyme Information: sr16703-t26_1-p1

Basic Information

• Species: Sporisorium reilianum
• Lineage: Basidiomycota; Ustilaginomycetes; ; Ustilaginaceae; Sporisorium; Sporisorium reilianum
• CAZyme ID: sr16703-t26_1-p1
• CAZy Family: GT39
• CAZyme Description: related to DCW1-Mannosidase, GPI-anchored membrane protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
366	FQ311443|CGC4	40202.55	8.3832

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SreilianumSRZ2	6791	999809	118	6673

• Gene Location: location=FQ311443:273121-274221(+)

Full Sequence      

MLWSSLYPLALFGLLTASSSTLANPVPAKVNRLQVDAAVHSLFSYYNATDGRFDTAASWW
LTGNALTGVLEWTAKTHSWQYMPQVMHTIHEQKKPLPWWPSGGGIFRADSTDDTGWYALA
MLRMFDITKDAKYLDYAVTDAEYLQSFESSACGGGIIWDIPSRTYKNAISNELYLSLTAG
LANRLHDKTKAKKYLDIAKKQYTWFVNSGMINKDSLINDGLTDGCANNGGKIWSYNQGVI
LGGLAELYKADGGKRKYLKLGRRIADAVLASPAFSTQGILTELCEPSSSCNSDQDAFKGI
FMRNLDKINKVLPGAPYTSYIQRPAAYAYSHDRNGTDFYGVQWTGPVGQANVGTQGSAVS
LLIAAL

Enzyme Prediction     

No EC number prediction in sr16703-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	44	351	1e-75	0.8379888268156425

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	4.96e-39	36	359	7	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	6.79e-11	103	364	84	345	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBQ71355.1|GH76	9.34e-274	1	366	1	366
SJX66381.1|GH76	2.76e-266	1	366	1	366
QKG20016.1|GH76	6.49e-125	37	366	31	359
ADI12151.1|GH76	1.09e-122	32	366	31	366
ADB50985.1|GH76	1.89e-102	32	366	58	386

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MU9_A	6.24e-14	112	345	118	340	Crystal structure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482],4MU9_B Crystal structure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482]
6U4Z_A	2.22e-07	112	267	232	391	Crystal Structure of a family 76 glycoside hydrolase from a bovine Bacteroides thetaiotaomicron strain [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9P6I3|YHG7_SCHPO	6.05e-26	42	337	41	344	Putative mannan endo-1,6-alpha-mannosidase C1198.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1198.07c PE=3 SV=2
sp|P36091|DCW1_YEAST	5.00e-20	46	363	52	382	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q05031|DFG5_YEAST	2.37e-19	46	362	57	388	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DFG5 PE=1 SV=1
sp|Q6FLP9|DCW1_CANGA	6.08e-18	46	343	49	357	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|Q9P6I4|YHG6_SCHPO	9.61e-17	35	342	35	367	Putative mannan endo-1,6-alpha-mannosidase C1198.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1198.06c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.011241	0.988712	CS pos: 23-24. Pr: 0.9417

TMHMM  Annotations     

There is no transmembrane helices in sr16703-t26_1-p1.