CAZyme Information: sr15690-t26_1-p1

Basic Information

• Species: Sporisorium reilianum
• Lineage: Basidiomycota; Ustilaginomycetes; ; Ustilaginaceae; Sporisorium; Sporisorium reilianum
• CAZyme ID: sr15690-t26_1-p1
• CAZy Family: GT2
• CAZyme Description: related to Endoglucanase 1 precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
513		50561.73	7.0865

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SreilianumSRZ2	6791	999809	118	6673

• Gene Location: location=FQ311438:315871-317412(+)

Full Sequence      

MGVRIKSSLAVVLAAISLSSFITTSNAYNPPTGPFATRFWDCCRAAFSYDKPSAGLYSAV
DTCQKDGVTLIPKEEQMSGKNGCDDGGNQFTCNCIQPWLDSVDSELAYGFGAYNIHDPDG
TIENTCWYVEFLPQDPNGKTLKVRKMILQNINTSQGLPKGSWDFNLAGGGVGDYNKGCSN
QWGSDWGQRFGGVDNEQACCKLPEGLRSSCLFRFTMFGDNPGLASTPKRVRCPVGLIDRS
GAQRKDDASVAPYSGKTDKTGYPAPDKYQRNRSVCQNIDPLGIVSSVCGGSGGGSRLPKG
YGMVRQDSPGGKVPDDGGSSGSSTAPDTTATQPQPQPGTGSQGESYGTAPDANVLAGGGA
GGAGLGSGDVTGGGAGGGAGAGAGAGAGAGGAAGPGGVPGAGADNSARAGLGRGAGPVVG
PGAGLGGGVGTGFGPGPGAGPGAGPGVGPSAGAGAGAGPGSATNSPSAQPPTTPPGAGPF
GMPADHGAGSPNPFGPLPGLAGHRRSTCLQGKH

Enzyme Prediction     

EC	3.2.1.4:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH45	36	242	5.3e-41	0.9797979797979798

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
280233	Glyco_hydro_45	2.39e-55	36	243	4	214	Glycosyl hydrolase family 45.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBQ69772.1|GH45	2.57e-281	1	513	1	513
SJX65420.1|GH45	8.54e-273	1	513	1	513
CDU22085.1|GH45	5.90e-222	1	358	1	350
SAM85129.1|GH45	6.39e-164	1	321	57	373
AAB36147.1|GH45|3.2.1.4	8.92e-71	36	275	29	267

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5H4U_A	2.00e-31	16	244	5	221	Crystal structure of cellulase from Antarctic springtail, Cryptopygus antarcticus [Cryptopygus antarcticus],5H4U_B Crystal structure of cellulase from Antarctic springtail, Cryptopygus antarcticus [Cryptopygus antarcticus],5H4U_C Crystal structure of cellulase from Antarctic springtail, Cryptopygus antarcticus [Cryptopygus antarcticus]
1HD5_A	5.58e-29	36	249	5	206	Endoglucanase from Humicola insolens AT 1.7A resolution [Humicola insolens]
2ENG_A	2.55e-28	36	249	5	206	Endoglucanase V [Humicola insolens]
3ENG_A	2.75e-28	36	249	5	206	STRUCTURE OF ENDOGLUCANASE V CELLOBIOSE COMPLEX [Humicola insolens]
6MVI_A	4.83e-28	36	292	28	269	Apo Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A],6MVJ_A Cellobiose complex Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P54424|GUN1_USTMA	1.59e-71	36	275	29	267	Endoglucanase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=EGL1 PE=2 SV=1
sp|D3GDK4|GUN_CRYAT	8.81e-31	16	244	5	221	Endoglucanase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1
sp|P45699|GUNK_FUSOX	4.03e-29	36	257	24	234	Putative endoglucanase type K OS=Fusarium oxysporum OX=5507 PE=2 SV=1
sp|P43316|GUN5_HUMIN	1.41e-27	36	249	5	206	Endoglucanase-5 OS=Humicola insolens OX=34413 PE=1 SV=1
sp|O97401|GUN_PHACE	7.06e-21	11	237	4	235	Endoglucanase OS=Phaedon cochleariae OX=80249 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000205	0.999727	CS pos: 27-28. Pr: 0.9772

TMHMM  Annotations     

Start	End
7	29