CAZyme Information: sr15253-t26_1-p1

Basic Information

• Species: Sporisorium reilianum
• Lineage: Basidiomycota; Ustilaginomycetes; ; Ustilaginaceae; Sporisorium; Sporisorium reilianum
• CAZyme ID: sr15253-t26_1-p1
• CAZy Family: GT1
• CAZyme Description: related to endo-1,3(4)-beta-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
778	FQ311435|CGC4	81948.12	9.4134

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SreilianumSRZ2	6791	999809	118	6673

• Gene Location: location=FQ311435:216644-218983(+)

Full Sequence      

MVNLMLRLTVVVQAALLLLALQHAATPAHAFWGRGRPVPVNQEERTLAPHVVDVSNIPAA
SAFEHADSPAKRTDADADADEDDDDDFDELEIITVFLPEEVDEDEEGANALHKRAGPTPC
PANHTRRARSLPTAHAHDKREPNPDPKVVYRTRTRTRTVTVTRTIYETVYRRCTEYVRRA
TSSKRKTTSTRRKTTSTRRTTSTTPTSTRRTTSTTPVTTPKPSTSSTNRALTTSSTTPKP
SSSTVSTTSTTPRSSTTSTSTTTKTSTTSTSTTKTSSSSSSTTTSSSSSSVPRSPPSSTS
SSTTSSTPRSTPSSTSSSSSSASTSSSTSSSSTTSSSTTSSTVTPTPTPKVYSLMANYNG
ANFYNNMYFFTFKYPTNGLVDYIGRDEASSMGLVKTTNGGQVFMAYATTRVYPPSSTTSS
TSTSTSTSTSSKSTSTSSSSAPKQRRAVTTSSSASSASASSSSSASKASTTSSSASVSVQ
AVTKSSTSTTGTASTATTTGTGSTSGSSTSSSSAAATSSAAPIPYMKSVRVSSYDTFTTG
VFILDASHMPVGCGVWPAWWTVPTNPAGGWPNGGEIDVVEGISFTSQNTYSVHTAPGCRV
NATTNSQLGSYQLQNLTQATNCASAETGNQGCGVQSSLRNDYGTGYNAQGGGIHAMVWDA
DEGIKAWFFSRSNAPADIAAGKPDPTGWGQPQASWPATNCDPNTFFFNHVSVFTNTICGD
WAGSQTLWNNAYAGQTQSCAKMTGYPTCQSYVQSKDVDFSQAYWLINSVKIYQTKRTY

Enzyme Prediction     

No EC number prediction in sr15253-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	521	752	1.7e-68	0.8951965065502183

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185690	GH16_fungal_Lam16A_glucanase	8.77e-104	352	773	2	293	fungal 1,3(4)-beta-D-glucanases, similar to Phanerochaete chrysosporium laminarinase 16A. Group of fungal 1,3(4)-beta-D-glucanases, similar to Phanerochaete chrysosporium laminarinase 16A. Lam16A belongs to the 'nonspecific' 1,3(4)-beta-glucanase subfamily, although beta-1,6 branching and beta-1,4 bonds specifically define where Lam16A hydrolyzes its substrates, like curdlan (beta-1,3-glucan), lichenin (beta-1,3-1,4-mixed linkage glucan), and laminarin (beta-1,6-branched-1,3-glucan).
185693	GH16_laminarinase_like	3.93e-11	549	607	88	148	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185694	GH16_CCF	4.18e-04	523	580	96	155	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBQ69184.1|GH16_1	2.34e-281	1	778	1	778
SJX64824.1|GH16_1	2.74e-261	1	778	1	774
CDU22272.1|GH16_1	2.20e-213	1	778	1	810
CDI55237.1|GH16_1	3.83e-185	353	778	448	879
SAM84191.1|GH16_1	3.09e-175	350	777	394	777

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2CL2_A	5.94e-49	524	773	67	298	Chain A, PUTATIVE LAMINARINASE [Phanerodontia chrysosporium],2W39_A Chain A, Putative Laminarinase [Phanerodontia chrysosporium],2W52_A Chain A, PUTATIVE LAMINARINASE [Phanerodontia chrysosporium]
2WLQ_A	2.92e-48	524	773	67	298	Chain A, PUTATIVE LAMINARINASE [Phanerodontia chrysosporium],2WNE_A Chain A, PUTATIVE LAMINARINASE [Phanerodontia chrysosporium]
5JVV_A	8.06e-45	527	772	71	297	Crystal structure and characterization an elongating GH family 16 beta-1,3-glucosyltransferase [Paecilomyces sp. 'thermophila'],5JVV_B Crystal structure and characterization an elongating GH family 16 beta-1,3-glucosyltransferase [Paecilomyces sp. 'thermophila']
3WDU_A	3.43e-43	527	772	68	295	The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila'],3WDU_B The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila'],3WDU_C The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila'],3WDU_D The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila']
3WDT_A	3.52e-43	527	772	69	296	The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDT_B The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDT_C The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDT_D The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDV_A The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDV_B The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDV_C The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDV_D The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila']

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9USW3|YHZ7_SCHPO	7.48e-49	528	773	194	418	Probable glycosidase C21B10.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC21B10.07 PE=3 SV=1
sp|A1C7B5|EGLX_ASPCL	1.50e-39	524	773	98	328	Probable endo-1,3(4)-beta-glucanase ACLA_073210 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=ACLA_073210 PE=3 SV=1
sp|B0XTU6|EGLX_ASPFC	3.07e-39	527	773	100	327	Probable endo-1,3(4)-beta-glucanase AFUB_029980 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=AFUB_029980 PE=3 SV=1
sp|Q4X084|EGLX_ASPFU	3.07e-39	527	773	100	327	Probable endo-1,3(4)-beta-glucanase AFUA_2G14360 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=AFUA_2G14360 PE=3 SV=1
sp|A1DHY9|EGLX_NEOFI	5.81e-38	524	773	97	327	Probable endo-1,3(4)-beta-glucanase NFIA_089530 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=NFIA_089530 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000192	0.999793	CS pos: 30-31. Pr: 0.9098

TMHMM  Annotations     

There is no transmembrane helices in sr15253-t26_1-p1.