CAZyme Information: sr15239-t26_1-p1

Basic Information

• Species: Sporisorium reilianum
• Lineage: Basidiomycota; Ustilaginomycetes; ; Ustilaginaceae; Sporisorium; Sporisorium reilianum
• CAZyme ID: sr15239-t26_1-p1
• CAZy Family: GH9
• CAZyme Description: related to glycosyl transferase, group 2 family protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
480	FQ311435|CGC1	54802.76	9.1212

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SreilianumSRZ2	6791	999809	118	6673

• Gene Location: location=FQ311435:153816-155258(-)

Full Sequence      

MGTQGAMRGTLGSVSAFIYGWTPMILLACYCVFGFFFYLVIPPILQEVLFYIFLVLQTFT
SLSVSTEAMQSIRPSVKARRAFRKAAAEGWGETENGKPWPKIDIVLVAYLPNEKDIIVRQ
LRYALREINYPSDKLMINLVYNTPKPIEPVETELRELEAAHARLRVIKVPNSTSKADNIN
HYLSLDFKCDIITLYDTDHYPDPNAIRWVARRFLQGGIDIIQGRCCIYNYDETWLTRLVA
AEFDMIYGVMHSGRAEVQGYGFFGGSNGHWNASLLKTLGMQKHMLTEDIDSSMRAIISGA
RIEYDLRVLSYELAPETVPALVKQRLRWAQGWTQVAFRHALPAVRRGAYSDDNGWRSRIG
LFQLLVYRELYFYINTQLAFILVSSLITSLPGEGLKAWFSNFGGFALAMWALGVNLICLF
VTMCIVLKNRSNFTHPTGIIAFGLLAPFYYTIVSFMSIFCHFREFIKFEKWNPTARSSKK

Enzyme Prediction     

No EC number prediction in sr15239-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	112	329	2.3e-25	0.9391304347826087

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224136	BcsA	1.67e-28	97	455	51	397	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	4.23e-28	104	288	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
133049	CESA_like_2	1.18e-27	117	339	15	237	CESA_like_2 is a member of the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, Glucan Biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of glucan.
133059	CESA_CaSu_A2	1.08e-20	105	331	3	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.
404520	Glyco_tranf_2_3	1.44e-20	100	331	2	230	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBQ69170.1|GT2	0.0	1	480	1	480
SJX64810.1|GT2	0.0	1	480	1	480
CDU22257.1|GT2	0.0	1	480	1	480
SAM84173.1|GT2	0.0	1	480	1	480
CDI55222.1|GT2	0.0	1	480	1	480

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	1.08e-09	99	347	272	515	Chain A, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P58932|BCSA_XANAC	3.16e-10	99	347	152	395	Cellulose synthase catalytic subunit [UDP-forming] OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=bcsA PE=3 SV=1
sp|Q8X5L7|BCSA_ECO57	4.19e-09	99	347	272	515	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli O157:H7 OX=83334 GN=bcsA PE=3 SV=2
sp|P58931|BCSA_PSEFS	5.17e-09	90	347	150	401	Cellulose synthase catalytic subunit [UDP-forming] OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=bcsA PE=3 SV=2
sp|P37653|BCSA_ECOLI	5.53e-09	99	347	272	515	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli (strain K12) OX=83333 GN=bcsA PE=1 SV=3
sp|Q8Z291|BCSA_SALTI	1.68e-08	99	347	272	515	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhi OX=90370 GN=bcsA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999988	0.000009

TMHMM  Annotations     

Start	End
17	39
43	65
371	390
405	427
440	462