CAZyme Information: sr14508-t26_1-p1

Basic Information

• Species: Sporisorium reilianum
• Lineage: Basidiomycota; Ustilaginomycetes; ; Ustilaginaceae; Sporisorium; Sporisorium reilianum
• CAZyme ID: sr14508-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
390	FQ311474|CGC2	42752.04	7.6737

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SreilianumSRZ2	6791	999809	118	6673

• Gene Location: location=FQ311474:342271-343506(-)

Full Sequence      

MRSFAYFPALYVVLTLLATLVRAAPVEGHPHTGALKEQCQAPKTSSDDPLAGCPRGTVFV
SQKHPNAAFRTINAAVSALPDDGSTRTVLIDEGMYYEKVVVSRISPTIFAGITPNVRDPL
ANRVRMWQSSYVNQSDAHSTLRNCDAVVLGVGTGAPVGSADFKAYNIDFVQRQFFEGQEV
TQYQLGPAAALCVQRSNASFYGCGFASYQDTLYVGDGAQAFFFASVVRGMTDQLYGSGKA
WFERVKLLSRACGGGITAWRGDPADPSVGVYVSNSHIDRSDDASTLKNLTARCHLGRPWN
VYSHATYLNTTMSDIVNPDGFRVWGQFQSNFDPKLTRFAEYASSGPGGNLELRNTTLERI
LTEHEAKQITFKRVFGGDTHWIDAKPVQQW

Enzyme Prediction     

No EC number prediction in sr14508-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	61	375	2.3e-54	0.9791666666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395871	Pectinesterase	2.77e-30	69	378	12	298	Pectinesterase.
178521	PLN02933	3.06e-29	69	384	230	521	Probable pectinesterase/pectinesterase inhibitor
215130	PLN02217	3.16e-25	69	387	262	555	probable pectinesterase/pectinesterase inhibitor
215535	PLN02990	9.25e-24	69	382	271	560	Probable pectinesterase/pectinesterase inhibitor
215173	PLN02304	2.72e-23	69	353	87	347	probable pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBQ73920.1|CE8	3.39e-295	1	390	1	390
SJX63760.1|CE8	1.04e-289	1	390	1	390
CDR87315.1|CE8	3.04e-234	1	390	1	390
SAM83392.1|CE8	2.01e-194	1	390	1	396
CDI54281.1|CE8	2.06e-161	1	388	1	397

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	1.89e-24	54	383	7	296	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	2.60e-24	54	383	7	296	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	3.29e-20	69	384	19	310	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	1.19e-14	69	387	15	309	Chain A, Pectinesterase 1 [Solanum lycopersicum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DBT4|PMEA_NEOFI	1.24e-25	69	384	44	322	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1
sp|A2QK82|PMEA_ASPNC	5.97e-24	54	383	35	324	Probable pectinesterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pmeA PE=3 SV=1
sp|Q9ZQA3|PME15_ARATH	6.73e-24	13	382	34	385	Probable pectinesterase 15 OS=Arabidopsis thaliana OX=3702 GN=PME15 PE=2 SV=1
sp|B0Y9F9|PMEA_ASPFC	2.54e-22	54	384	32	322	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
sp|Q4WBT5|PMEA_ASPFU	2.54e-22	54	384	32	322	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000215	0.999748	CS pos: 23-24. Pr: 0.9805

TMHMM  Annotations     

There is no transmembrane helices in sr14508-t26_1-p1.