CAZyme Information: sr14179-t26_1-p1

Basic Information

• Species: Sporisorium reilianum
• Lineage: Basidiomycota; Ustilaginomycetes; ; Ustilaginaceae; Sporisorium; Sporisorium reilianum
• CAZyme ID: sr14179-t26_1-p1
• CAZy Family: GT8
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
617		68008.61	9.1535

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SreilianumSRZ2	6791	999809	118	6673

• Gene Location: location=FQ311472:877336-879364(-)

Full Sequence      

MKVALLANPARGEINVLLATAYELIRLGHDVTFLTGSSFRNAIAEFRSEQNDPVLASRIH
FSDLGGARAVEDFTRGMQSHLKGLRKPPGDYSSMEICQIVALVTEQEFRDAATTVRDCLL
EIEPDMIAVDALSPNLVTGCRMTGLPWMFTVPCSPSLTATRKSLFDPHPMARRRKRSLMS
SLENLKLTVIETWANATKKDLYARRALLKNEFGLNSMGFNGDSAIVPPLWKDRNCVGGIH
FNTPGLTDSIRQPHQITFVGAGVTSDPENHDSPTHDYASSIKPISPALSTTFHKAALPTL
PYGERDEDVEWMDAAYAAGQSVVYLNMGSMFLWTDSEVRACLRAFDRLYQLSGGKIKLLF
KLNKPKRNPGSPGSASPSATPVSPVSPGFDEKRPELDSRRLSGASTLVAEKLSEAIKNSV
KLRRKIKAEQGYSLITLSEFEGLEYVRFTRWVHDQRRIYKHPALKVVIHHGGGNSFNEAI
HYGLPQMVLSQWFDTHEYAILAERFGIGLRSKHAPYIDEDDMVNKMLRLLQGEEAEKIRR
NTKVWSVRSRNAGGAPAAARLIETQALLFNQQKQAKLAAAAGKTASVEALATRSIGSDAA
FTPELGSSAASTIANIE

Enzyme Prediction     

No EC number prediction in sr14179-t26_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	4.73e-22	1	563	1	402	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	7.16e-08	1	564	2	397	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
178170	PLN02555	5.71e-06	455	545	347	442	limonoid glucosyltransferase
177830	PLN02173	7.10e-05	455	555	327	434	UDP-glucosyl transferase family protein
215127	PLN02210	7.66e-05	410	557	288	443	UDP-glucosyl transferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBQ73522.1|GT1	0.0	1	617	1	617
SJX63359.1|GT1	0.0	1	617	1	617
CDU26159.1|GT1	0.0	1	592	1	591
CDI53946.1|GT1	0.0	1	583	1	582
SAM82152.1|GT1	0.0	1	586	1	581

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LVY_A	6.41e-06	462	534	357	428	Chain A, UDP-glycosyltransferase 203A2 [Tetranychus urticae],7MCO_A Chain A, UDP-glycosyltransferase 203A2 [Tetranychus urticae],7MCO_B Chain B, UDP-glycosyltransferase 203A2 [Tetranychus urticae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A0D1DZV5|EMT1_USTMA	0.0	1	579	1	575	Erythritol-mannosyl-transferase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=EMT1 PE=1 SV=1
sp|M9MH90|EMT1_PSEA3	0.0	1	576	1	573	Erythritol-mannosyl-transferase 1 OS=Pseudozyma antarctica (strain T-34) OX=1151754 GN=EMT1 PE=1 SV=1
sp|A0A1B4XBH6|SDNJ_SORAA	1.81e-07	446	534	366	457	Glycosyltransferase sdnJ OS=Sordaria araneosa OX=573841 GN=sdnJ PE=1 SV=1
sp|A0A411KZY6|BUAB_ASPBU	3.05e-07	441	522	346	430	Glycosyltransferase buaB OS=Aspergillus burnettii OX=2508778 GN=buaB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000001

TMHMM  Annotations     

There is no transmembrane helices in sr14179-t26_1-p1.