CAZyme Information: sr13673-t26_1-p1

Basic Information

• Species: Sporisorium reilianum
• Lineage: Basidiomycota; Ustilaginomycetes; ; Ustilaginaceae; Sporisorium; Sporisorium reilianum
• CAZyme ID: sr13673-t26_1-p1
• CAZy Family: GT71
• CAZyme Description: related to Alpha-1,6-mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
522		59071.97	8.7830

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SreilianumSRZ2	6791	999809	118	6673

• Gene Location: location=FQ311471:426346-427914(-)

Full Sequence      

MFSFFTSDKGKRRDDRFLPLTDIKIGPFKIGSTSSTPNSECSYSALTSSTETAIDFPHDG
RSSLDRYRESASPPPGYHKPPSYYSALFGATHRRAKSSSRRCKLITLAVIVLPCLYIFCY
ITFRPPSYIVLPPERYVQTLRDTLTHHIPSEASRQALSDHLARIEHPEPGASTTSPSSIA
PQQPSSPFPNPVSVVPPTIWSSDGKPAPSAWFTKWSQMGFDPKFLDDAGAEGWIKSHFDN
TSIQHMWDSMPRFILKADLLRYLLMLQEGGTWSDMDTVPLMHRTNWTKDAVPLSSVLPQD
KGIFGRAGLNSTTRASGASPELVRVVIGIENDPNENHDPRNFFERLRLLPLRRHRPLQFV
QWTLHCAPNHPIMLDVLRRILQATEVYRGYEVEQQREAFSDGWGWGEKSIEDKKEQAKMR
EAHQGHPWDGTAMSWKWQAGRWRWGWDVLSVEEWTGPAVFTDSVVSYLYATAGVRPEDLS
MLKQPVQIRDVVIVPSLGFNPTGARPEGVSRLVHLFRGSWKG

Enzyme Prediction     

No EC number prediction in sr13673-t26_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	4.40e-06	140	290	40	181	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.19e-05	226	286	25	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBQ73009.1|GT32	0.0	1	522	1	522
SJX62846.1|GT32	0.0	1	522	1	522
CDU22770.1|GT32	0.0	1	522	1	536
SAM81963.1|GT32	3.09e-290	1	522	1	526
CDI53488.1|GT32	2.47e-284	1	522	1	524

PDB Hits     

sr13673-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	1.12e-24	195	521	142	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P31755|OCH1_YEAST	1.76e-13	250	521	163	470	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q5A4E3|OCH1_CANAL	2.03e-12	250	521	165	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	5.09e-12	200	500	138	362	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000040	0.000002

TMHMM  Annotations     

Start	End
104	123