CAZyme Information: sr13576-t26_1-p1

Basic Information

• Species: Sporisorium reilianum
• Lineage: Basidiomycota; Ustilaginomycetes; ; Ustilaginaceae; Sporisorium; Sporisorium reilianum
• CAZyme ID: sr13576-t26_1-p1
• CAZy Family: GH36
• CAZyme Description: probable cytochrome c peroxidase precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
396		42891.06	7.9896

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SreilianumSRZ2	6791	999809	118	6673

• Gene Location: location=FQ311442:654215-655405(-)

Full Sequence      

MASLRTGLRVAQPLRAGARNFARPSIRSSVRHYSSPAAGSPPPPPPSSSSSTTKVLLTSV
AIAAVAGGAFLAFGQDDKKALLGVGPDGANKLHGSKGSAGAATSAHSKADYQAVYNAIAE
QLESNPEYDDGSYGPVLVRLAWHASGTYDKHSNTGGSNGATMRFAPESDHGANAGLGVAR
DFMEKIHNKFPWITYSDLWTLGGVAAIQELGGPKIPWRPGRLDATADKCTPDGRLPDGDK
GPDHLRYIFYKMGFNDQEIVALSGAHALGRCHTDRSGFEGPWTFAPTSFTNEYFNLLMNE
KWSMRKWNGPPQFEDKSTKSLMMLMTDMALVQDAAFKKHVQRYAKSEDEFFNDFRGAFAK
LLELGVPAENFKAFETKLDGGRPFEFSTTAEQENSK

Enzyme Prediction     

No EC number prediction in sr13576-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	118	366	2e-60	0.9647058823529412

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173825	ascorbate_peroxidase	2.87e-143	108	369	10	253	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.
178218	PLN02608	5.96e-82	135	365	32	243	L-ascorbate peroxidase
166005	PLN02364	2.58e-67	134	365	33	246	L-ascorbate peroxidase 1
178467	PLN02879	4.95e-66	134	365	34	246	L-ascorbate peroxidase
223453	KatG	1.88e-64	110	371	69	433	Catalase (peroxidase I) [Inorganic ion transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR83235.1|AA2	1.10e-140	110	367	157	414
QRD85779.1|AA2	7.40e-140	108	370	88	350
QMW29426.1|AA2	7.40e-140	108	370	88	350
QMW41498.1|AA2	7.40e-140	108	370	88	350
UDD58631.1|AA2	7.40e-140	108	370	88	350

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2V2E_A	5.45e-93	110	392	18	292	Structure of isoniazid (INH) bound to cytochrome c peroxidase mutant N184R Y36A [Saccharomyces cerevisiae]
2V23_A	5.82e-93	110	392	20	294	Structure of cytochrome c peroxidase mutant N184R Y36A [Saccharomyces cerevisiae],4A6Z_A Cytochrome c peroxidase with bound guaiacol [Saccharomyces cerevisiae]
4A71_A	8.23e-93	110	392	20	294	cytochrome c peroxidase in complex with phenol [Saccharomyces cerevisiae]
3M23_A	1.98e-92	110	392	15	289	Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M25_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M26_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M27_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M28_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M29_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2A_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2B_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2C_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2D_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2E_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2F_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2G_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2H_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2I_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae]
5EJT_A	2.18e-92	110	392	18	292	Thermally annealed ferryl Cytochrome C Peroxidase crystal structure [Saccharomyces cerevisiae S288C],5EJX_A X-ray Free Electron Laser Structure of Cytochrome C Peroxidase [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4PBY6|CCPR_USTMA	1.89e-250	1	395	1	397	Cytochrome c peroxidase, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CCP1 PE=3 SV=1
sp|Q4WPF8|CCPR_ASPFU	1.86e-141	108	376	92	364	Cytochrome c peroxidase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=ccp1 PE=3 SV=1
sp|Q7SDV9|CCPR_NEUCR	2.83e-141	110	370	86	347	Cytochrome c peroxidase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=ccp-1 PE=3 SV=1
sp|P0C0V3|CCPR_EMENI	3.14e-141	97	367	74	346	Cytochrome c peroxidase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ccp1 PE=3 SV=1
sp|Q4ING3|CCPR_GIBZE	1.07e-138	107	367	80	340	Cytochrome c peroxidase, mitochondrial OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=CCP1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999789	0.000230

TMHMM  Annotations     

There is no transmembrane helices in sr13576-t26_1-p1.