CAZyme Information: sr12557-t26_1-p1

Basic Information

• Species: Sporisorium reilianum
• Lineage: Basidiomycota; Ustilaginomycetes; ; Ustilaginaceae; Sporisorium; Sporisorium reilianum
• CAZyme ID: sr12557-t26_1-p1
• CAZy Family: GH16
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
609	FQ311452|CGC5	67001.92	6.3268

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SreilianumSRZ2	6791	999809	118	6673

• Gene Location: location=FQ311452:175347-177176(+)

Full Sequence      

MKLTTLVPFTALALALASSAPGTTATPTTRQQATFIPAPGDIVSRNADGRATEDAYGDPS
YDYPVPNPSLPLDALPDARPVPAARRFRSRLVEAEIRRISAKIADPAVRRIFTNAYPNSL
DTTVAWTDLQLDNPDTSTAFPRAFVITGDILAAWLRDSSNQLFTYLPLLRDPPAPYTVGG
EDWVKLYRLALGLLYQQAQQVIAYPLGNSFGPPRSAGITNKHNPAVEGGKGADWVQPPVP
GQKAHYLPQPPHNYSHVEGTDGVYLWETKWEVDSLAAHLRLPSLIAEYANRTDFVRNRTW
QRGVRMALDALRSQQRSSHEEHTAYEASNDTTILPANLTARDGEWAQRFGTLQGGVYRFE
RLDRSATETKADHGWGEPAQRNGLVKSAFRPSDDATTFPHLIPANAQLAVALEKLHPLLE
DVEEMHDVAQNARAFAAEIRTAITAHAIRPNHLAAGDVYAYEIDGYGSTYFADDANIPSL
LSLPYLGYVNATDAVYQRTRAFVLSPRTNKWAFTGTQFRGIGGPHVGTGYAWPMSLAMQI
LTSSDAQEQLDALSLLRNTTAGTGLIHESINVHNASDFTRDWFGWANGLFGEAVRHIEQT
NPQVLAHTY

Enzyme Prediction     

No EC number prediction in sr12557-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	105	594	2.2e-124	0.9950248756218906

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	105	594	1	415	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	3.36e-116	83	594	1	419	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBQ71711.1|GH125	0.0	1	609	1	609
SJX61582.1|GH125	0.0	1	609	1	595
CDI52372.1|GH125	0.0	1	609	1	606
CDR87157.1|GH125	0.0	64	609	47	591
CDS06540.1|GH125	6.88e-107	56	605	7	507

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3P2C_A	5.80e-76	77	594	19	447	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
3ON6_A	8.15e-75	62	594	6	445	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
2P0V_A	3.31e-74	79	594	43	465	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3QT3_A	5.67e-71	99	594	19	419	Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Clostridium perfringens CPE0426 apo-structure [Clostridium perfringens],3QT9_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Clostridium perfringens CPE0426 complexed with alpha-1,6-linked 1-thio-alpha-mannobiose [Clostridium perfringens]
6RQK_A	7.02e-71	99	594	19	419	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	4.59e-96	63	605	39	504	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000518	0.999441	CS pos: 30-31. Pr: 0.5320

TMHMM  Annotations     

There is no transmembrane helices in sr12557-t26_1-p1.