CAZyme Information: sr12165-t26_1-p1

Basic Information

• Species: Sporisorium reilianum
• Lineage: Basidiomycota; Ustilaginomycetes; ; Ustilaginaceae; Sporisorium; Sporisorium reilianum
• CAZyme ID: sr12165-t26_1-p1
• CAZy Family: GH135
• CAZyme Description: related to SPR1-exo-1,3-beta-glucanase precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
619		69283.57	6.1058

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SreilianumSRZ2	6791	999809	118	6673

• Gene Location: location=FQ311441:131323-133182(+)

Full Sequence      

MKITSFGLAAIALALMADNTEALPAMRSYKGVSPYKARTTVNPTMPAMKDPRSIPGARRM
RLSSNEQLEATYRDELHYIPMHAEPEAASQFWNNVQHRLESAIDRLDRATSMLGVGSAVP
PSRAASAVKSAAKSLGFSFSVNSRKGAHGSSTPEFTFNFNVSEPLAWGEEAELSAATRED
AIMDGKALPNLPKDSGFDYTNNKVRGVNLGNWLLFEAWMDSSLMQQLNDHAINAPTANPI
IDEWTAGLYSDPGWAAYVLQKHFDEWMTESDWKAIKAAGLNHVRIPVPYFMFKEAVGPNA
PYLTLNRFAKLKEGVLLAKKYGLKVWIDLHSVPGSQNGFDNSGRSGPINWANNPSYYTQT
QYAFNRLVTEFTQSTYDGVVTAIEAVNEPKGNSVPAVQELLNKYYPWARNQVAVPDGWNK
YSNMLLAVHDGFQGLQYWQNFWTGRARHRVLLDTHPYFVYSDWEHSATDTQRLQEVCNLV
SSFQQSQQYYPSIAGEWAVNGPNGDRAADRDLPVGPVKFPSGPDYPYSVKYMAFMARNFR
TQQFVFEQGGGWIFWSWRNDNNPDWSYSTGLKYGWIPTDLDAQPYGANPCSCIPSLMQAA
KDGSAEASWTQLELEGETY

Enzyme Prediction     

EC	3.2.1.58:29	3.2.1.21:6	3.2.1.75:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	261	559	1.3e-81	0.9933993399339934

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	1.42e-27	188	463	2	248	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	2.47e-08	268	561	26	272	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBQ70267.1|GH5_9	0.0	1	619	1	619
SJX60939.1|GH5_9	0.0	1	619	1	619
CDR88234.1|GH5_9	0.0	1	619	1	616
CDI51800.1|GH5_9	0.0	1	613	1	609
SAM75227.1|GH5_9	0.0	1	619	1	621

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	1.73e-53	197	590	2	391	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
3O6A_A	2.71e-53	197	590	7	396	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
1CZ1_A	3.33e-53	197	590	2	391	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	3.86e-53	197	590	8	397	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
2PBO_A	1.03e-52	197	590	8	397	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9URU6|EXG1_SCHPO	6.32e-56	197	587	32	404	Glucan 1,3-beta-glucosidase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=exg1 PE=2 SV=1
sp|Q12626|EXG_PICAN	1.71e-53	191	590	36	432	Glucan 1,3-beta-glucosidase OS=Pichia angusta OX=870730 PE=3 SV=1
sp|Q96V64|EXG_BLUGR	5.15e-53	187	583	20	410	Glucan 1,3-beta-glucosidase OS=Blumeria graminis OX=34373 PE=3 SV=1
sp|P29717|EXG1_CANAL	1.81e-52	197	590	46	435	Glucan 1,3-beta-glucosidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=XOG1 PE=1 SV=5
sp|A2RAR6|EXGA_ASPNC	2.03e-50	186	585	21	411	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000295	0.999696	CS pos: 22-23. Pr: 0.9749

TMHMM  Annotations     

There is no transmembrane helices in sr12165-t26_1-p1.