CAZyme Information: sr12155-t26_1-p1

Basic Information

• Species: Sporisorium reilianum
• Lineage: Basidiomycota; Ustilaginomycetes; ; Ustilaginaceae; Sporisorium; Sporisorium reilianum
• CAZyme ID: sr12155-t26_1-p1
• CAZy Family: GH13
• CAZyme Description: related to Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357	FQ311441|CGC4	39776.27	6.3133

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SreilianumSRZ2	6791	999809	118	6673

• Gene Location: location=FQ311441:101464-102537(-)

Full Sequence      

MEAKYVKWRDTYLRSSRAGLYCYYNGKGDNGNAITCSEAHGYAMLISVLHRNRADFDGLL
QFFRAFRNANGFMCWQIRSPHQPSSSAGAVEPYVEEDGRTSATDGDIDIASALYLAARVF
GGDGYRVEADRVASSLLEHAVHQELGTPLLGDWANRDSAEARRLYDSTRTSDFILSAFAL
FSRYHSNAHERQRWEWVLQSTKSAALACAGTTGFLPDFLEFHGTWQPARGKLLESEHDGA
LNWNACRTPWRLAHYLATTGDTAILPLLQHAHHSARTLPAFNFPTIPAGVDLAKHTPLVD
YSDKAFIAPVGYLCHVLSDTDGHQQCVRALESQGESYFGDTIDLLIAEQASHAHEWF

Enzyme Prediction     

No EC number prediction in sr12155-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	4	346	8.1e-51	0.978125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396020	Glyco_hydro_8	3.20e-21	30	346	27	315	Glycosyl hydrolases family 8.
225940	BcsZ	2.89e-11	28	230	47	235	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBQ70257.1|GH8	5.61e-275	1	357	1	357
SJX60929.1|GH8	3.11e-272	1	357	1	357
CDR88245.1|GH8	1.49e-234	1	357	1	359
SAM75117.1|GH8	3.64e-202	1	356	1	363
AXA50804.1|GH8	5.14e-132	1	356	1	358

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XD0_A	1.03e-37	1	344	62	396	Apo Structure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4],5XD0_B Apo Structure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4]
1V5C_A	6.47e-14	5	345	35	372	The crystal structure of the inactive form chitosanase from Bacillus sp. K17 at pH3.7 [Bacillus sp. (in: Bacteria)],1V5D_A The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)],1V5D_B The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)]
7CJU_A	6.77e-14	5	345	41	378	Crystal structure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7CJU_B Crystal structure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7XGQ_A Chain A, chitosanase [Bacillus sp. K17-2],7XGQ_B Chain B, chitosanase [Bacillus sp. K17-2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P19254|GUB_NIACI	5.28e-38	1	344	62	396	Beta-glucanase OS=Niallia circulans OX=1397 GN=bgc PE=3 SV=1
sp|P29019|GUN_BACSZ	4.32e-13	5	345	91	428	Endoglucanase OS=Bacillus sp. (strain KSM-330) OX=72575 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000000

TMHMM  Annotations     

There is no transmembrane helices in sr12155-t26_1-p1.