CAZyme Information: sr11706-t26_1-p1

Basic Information

• Species: Sporisorium reilianum
• Lineage: Basidiomycota; Ustilaginomycetes; ; Ustilaginaceae; Sporisorium; Sporisorium reilianum
• CAZyme ID: sr11706-t26_1-p1
• CAZy Family: GH10
• CAZyme Description: related to GPI14-Glycosylphosphatidylinositol-alpha 1,4 mannosyltransferase I

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
574	FQ311430|CGC1	64079.55	9.1470

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SreilianumSRZ2	6791	999809	118	6673

• Gene Location: location=FQ311430:983767-985584(-)

Full Sequence      

MKATLWPIIYIVAGILLRAGLLVWGQYQDATHTLPYTDVDYLVFSDAAKLLVDACPLSLT
VQRPDYESDADLVDRTDVHCARGIVPAAARFLLLNDPNTHSPSHSSRPDAMHYWAKQCYT
LAKSAFRLLASLGDPYARPTYRYTPFLAAILSPIHLFGWTNFGKYIFVASDLLCAVFMWL
ILDGRRPQGTAAGLYVHLPGLLWILNPMVAQISTRGSSEALVGLLVLSFLYFFLKANPEA
PLGLRAKYLPAFSAQHTANGVDHSKDKASVTDAEQTHEEGPTYEAIPPESAFNVLDWSLE
AYMAPILLGLATHLKLFPVIYAVPILSHLYRSTVSAYSPERRAKLSLWTKHAAGLQFGFV
AFYAFMACNVVAWLIWGSPFIEHTFLYHLHRADHRHNFSPYFLGTYLSLFTSHVSAASLE
ARILASPLLSFLPQLLVVTALGYHLGKRDVVAAMTAQTLAFVAFNKVCTSQYFLWFLWLL
PLVWPSLKVGKLETGLALAAWVGAQALWLSQAYQLEFEAKQVFARVWASGLVLVVVHAAL
LVWFLSSWARYRVDVRKHGLQARNGVFVKSKKSQ

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	301	543	7e-75	0.8893129770992366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	8.34e-47	11	542	12	412	GPI mannosyltransferase
252941	Mannosyl_trans	1.02e-46	300	545	26	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBQ67756.1|GT50	0.0	1	574	1	574
SJX60392.1|GT50	0.0	1	574	1	574
CDU23964.1|GT50	0.0	1	574	1	577
SAM70158.1|GT50	0.0	1	574	1	577
CDI51300.1|GT50	0.0	1	574	1	562

PDB Hits     

sr11706-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4I073|GPI14_GIBZE	4.81e-61	14	550	17	410	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1
sp|Q9P6R5|GPI14_SCHPO	2.23e-54	131	523	36	346	GPI mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpi14 PE=3 SV=2
sp|Q5F380|PIGM_CHICK	1.92e-53	13	557	14	414	GPI mannosyltransferase 1 OS=Gallus gallus OX=9031 GN=PIGM PE=2 SV=2
sp|Q2TXB8|GPI14_ASPOR	9.32e-53	7	517	8	378	GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi14 PE=3 SV=2
sp|Q5B7W0|GPI14_EMENI	1.77e-51	17	517	18	396	GPI mannosyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpi14 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.663959	0.336053

TMHMM  Annotations     

Start	End
5	27
146	168
188	210
217	234
301	323
354	376
423	445
458	480
526	548