CAZyme Information: sr11305-t26_1-p1

Basic Information

• Species: Sporisorium reilianum
• Lineage: Basidiomycota; Ustilaginomycetes; ; Ustilaginaceae; Sporisorium; Sporisorium reilianum
• CAZyme ID: sr11305-t26_1-p1
• CAZy Family: CE4
• CAZyme Description: related to Chitinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
538	FQ311444|CGC2	55973.20	9.7557

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SreilianumSRZ2	6791	999809	118	6673

• Gene Location: location=FQ311444:123756-125372(+)

Full Sequence      

MKLLPLGVLALASLLTSSAAAGDEFGQPHLPSQLGRTWNEHAGAGSSNTAQQDSRPVLSY
APDRPSAASTSTGHLAIQRRSLWQLLFGNEGGAGKQKRRAVPSARMLPRQRRRANSSRTK
RAKGSCKAPTSASASSSSSASATAATSTSSASPASPTNDSNETRTSTNKTMAAYWPDWTA
STLPPTSIDFSKFDILNYAFALPTADFSLSIPTDPSGGTLRRFVQACKAGDTKAVLSLGG
WGGSTYFSPAVRTAASRATFIANIVRTYNTYGLDGIDLDWEYPGQTGAGNQLDASDTANF
QTFLQELRAALPREALLTAAVGFTPWIGSSGAPVGSVARAAGVLDYVMIMNYDVWGSSSN
PGPNAPLANLCGNSTQPGANAAAGVRAWSAAGMPRNKILLGIPAYGYISQSSKQTLRTRS
PAKRAVKLTSSDGSSNSGQINFSSLVSQGALKLGKDGLYDATGGFTKYWDDCSDTPYLSD
GTRVVTYDDTSSIFDKGAFASAAGIGGISMWSLDGDTSTWALTNSAIAGMSSTGVISS

Enzyme Prediction     

No EC number prediction in sr11305-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	168	519	3.8e-69	0.9493243243243243

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214753	Glyco_18	1.69e-72	172	516	3	334	Glyco_18 domain.
395573	Glyco_hydro_18	3.30e-68	170	516	1	307	Glycosyl hydrolases family 18.
119365	GH18_chitinase	7.90e-61	172	516	2	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
119351	GH18_chitolectin_chitotriosidase	7.85e-52	196	516	31	341	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
225862	ChiA	1.68e-48	159	518	27	425	Chitinase, GH18 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBQ71457.1|GH18	0.0	1	538	1	538
SJX66486.1|GH18	0.0	1	538	1	539
CDU24651.1|GH18	1.01e-285	1	538	1	544
CDI56735.1|GH18	2.46e-231	1	538	1	552
UOP56895.1|GH18	1.63e-160	167	535	237	681

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XWF_A	5.59e-46	171	524	4	363	Chain A, Fungal chitinase from Rhizomucor miehei (SeMet-substituted proteins) [Rhizomucor miehei]
6LE8_A	8.82e-34	198	525	36	357	Chain A, Probable endochitinase [Caenorhabditis elegans]
6LE7_A	8.99e-34	198	525	35	356	Chain A, Probable endochitinase [Caenorhabditis elegans]
6LDU_A	9.32e-34	198	525	36	357	Chain A, Probable endochitinase [Caenorhabditis elegans]
1ITX_A	8.87e-29	233	516	124	406	Chain A, Glycosyl Hydrolase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q11174|CHIT_CAEEL	7.51e-32	198	525	87	408	Probable endochitinase OS=Caenorhabditis elegans OX=6239 GN=cht-1 PE=1 SV=1
sp|O81862|CHIC_ARATH	1.19e-27	172	516	30	353	Class V chitinase OS=Arabidopsis thaliana OX=3702 GN=ChiC PE=1 SV=1
sp|P20533|CHIA1_NIACI	3.13e-27	233	516	156	438	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
sp|Q13231|CHIT1_HUMAN	1.98e-24	185	516	43	363	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1
sp|Q95M17|CHIA_BOVIN	6.85e-24	228	524	86	373	Acidic mammalian chitinase OS=Bos taurus OX=9913 GN=CHIA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000252	0.999723	CS pos: 21-22. Pr: 0.9723

TMHMM  Annotations     

There is no transmembrane helices in sr11305-t26_1-p1.