CAZyme Information: sr11248-t26_1-p1

Basic Information

• Species: Sporisorium reilianum
• Lineage: Basidiomycota; Ustilaginomycetes; ; Ustilaginaceae; Sporisorium; Sporisorium reilianum
• CAZyme ID: sr11248-t26_1-p1
• CAZy Family: CE4
• CAZyme Description: conserved hypothetical protein (fragment)

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
545		62222.93	5.5928

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SreilianumSRZ2	6791	999809	118	6673

• Gene Location: location=FQ311444:272-1909(+)

Full Sequence      

MLLVDEHEETVRKEFYKRNNVGWVARPGHNQDGYVRKGRFKKASNLNFTCHLSVAVERMM
DEQRPETLAQLRKFHSNPEYLKLDRKADQNADAETQDIEKDAEITRAPCPQDPADEPSEP
LGPDDWTDADETELYRRCLEICLPKMHPLAQAKGNIRIGQLILMIDSDTRVPEDCLLDAA
TEMTLSPEIGVLQHCSGVMLVSDSYFELCIAFFTRLVNFAISFTVANGDVAPFMGHNAIL
RWSAMQEAAFVDPEDGVLKYWSESHVSEDFNMALRLLMSGYITRWATYSNNGFEEGVSLT
CDDKLNRWQKYAFGCSELVLHRLWEWPFKGPFMPLFKTFLCSSAPIHYKFSASSYIFSYY
AIAAAFPMTWALYLVEGWCYPVLDPSFLTPFRIWVAVVVVFTIGGNVSQIIARYRAKVDS
LFNLVKEHAAWMLPMFVFFGGLSYHVCTALLSHPLGIDMMWGATNKDLADSNFFLEVPLI
WKRFWKVIVLCTVTIAVVIIMQITAIVPLSWSIQGFFTYWPLLLTAVSHLIYPIALNPAL
LRFSF

Enzyme Prediction     

No EC number prediction in sr11248-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	162	371	6.4e-49	0.9746192893401016

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	1.07e-47	161	374	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
224136	BcsA	8.57e-08	159	461	138	426	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	2.05e-07	159	269	79	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
133034	Glucan_BSP_MdoH	0.004	163	249	100	187	Glucan_BSP_MdoH catalyzes the elongation of beta-1,2 polyglucose chains of glucan. Periplasmic Glucan Biosynthesis protein MdoH is a glucosyltransferase that catalyzes the elongation of beta-1,2 polyglucose chains of glucan, requiring a beta-glucoside as a primer and UDP-glucose as a substrate. Glucans are composed of 5 to 10 units of glucose forming a highly branched structure, where beta-1,2-linked glucose constitutes a linear backbone to which branches are attached by beta-1,6 linkages. In Escherichia coli, glucans are located in the periplasmic space, functioning as regulator of osmolarity. It is synthesized at a maximum when cells are grown in a medium with low osmolarity. It has been shown to span the cytoplasmic membrane.
133057	CESA_NdvC_like	0.006	160	283	86	198	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBQ71416.1|GT0	0.0	1	545	1	545
SJX66441.1|GT0	0.0	1	545	528	1072
CDI56973.1|GT0	0.0	1	545	684	1230
SJX63886.1|GT0	5.86e-264	1	545	385	878
CDU25172.1|GT0	1.22e-263	1	545	387	879

PDB Hits     

sr11248-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

sr11248-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000045	0.000000

TMHMM  Annotations     

Start	End
356	378
391	413
428	450
487	509
519	541