CAZyme Information: sr10982-t26_1-p1

Basic Information

• Species: Sporisorium reilianum
• Lineage: Basidiomycota; Ustilaginomycetes; ; Ustilaginaceae; Sporisorium; Sporisorium reilianum
• CAZyme ID: sr10982-t26_1-p1
• CAZy Family: AA7
• CAZyme Description: related to Endoglucanase 1 precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
313	FQ311471|CGC1	33197.05	7.4868

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SreilianumSRZ2	6791	999809	118	6673

• Gene Location: location=FQ311471:54312-55370(-)

Full Sequence      

MVFSFHKSTLVIALTAASVGFFAPAAVKATDATMYYDCCKPSGSWMGKAPVYNPVATCLA
DGKTIVTGPKRDDPNSSGCGGGNEFQCSCQQPWTDAVNPTVGYAFAAMTSTTESENECAC
YVATFSGAKSGKINTLFYQVINDGGDVTSDGLDILVPGMGVGAMTQGCKNQWPNSDISKW
GKQYGGLDRDAAGCKNLPEDLQHGCMWRMTDWGDSVTMQGKPQRVRCSKGHIDRTGCQRK
DEPSTTFQGHYDSAHNGPAPDGYTPNPAVCNIGAGGNSKRTVSSNGQPFVARRHHQAHPV
ASRHASQASTCPV

Enzyme Prediction     

No EC number prediction in sr10982-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH45	32	238	2.6e-48	0.9848484848484849

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
280233	Glyco_hydro_45	1.71e-63	32	238	4	214	Glycosyl hydrolase family 45.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBQ72891.1|GH45	5.13e-242	1	313	1	313
SJX62725.1|GH45	4.22e-241	1	313	1	313
CDU22884.1|GH45	1.22e-196	1	311	1	308
SAM81848.1|GH45	3.34e-152	5	298	3	289
CDI53377.1|GH45	2.95e-139	1	296	1	294

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5H4U_A	1.60e-40	33	243	25	225	Crystal structure of cellulase from Antarctic springtail, Cryptopygus antarcticus [Cryptopygus antarcticus],5H4U_B Crystal structure of cellulase from Antarctic springtail, Cryptopygus antarcticus [Cryptopygus antarcticus],5H4U_C Crystal structure of cellulase from Antarctic springtail, Cryptopygus antarcticus [Cryptopygus antarcticus]
6MVI_A	1.19e-38	6	242	2	226	Apo Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A],6MVJ_A Cellobiose complex Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A]
1L8F_A	1.15e-36	31	242	4	203	Structure of 20K-endoglucanase from Melanocarpus albomyces at 1.8 A [Melanocarpus albomyces]
1OA7_A	1.40e-36	31	242	4	203	Structure of Melanocarpus albomyces endoglucanase in complex with cellobiose [Melanocarpus albomyces],1OA9_A Structure of Melanocarpus albomyces endoglucanase [Melanocarpus albomyces]
5GLY_A	1.91e-36	31	244	6	207	Crystal structure of a glycoside hydrolase in complex with cellotetrose from Thielavia terrestris NRRL 8126 [Thermothielavioides terrestris NRRL 8126],5GM9_A Crystal structure of a glycoside hydrolase in complex with cellobiose [Thermothielavioides terrestris NRRL 8126]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P54424|GUN1_USTMA	1.15e-73	27	273	24	270	Endoglucanase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=EGL1 PE=2 SV=1
sp|D3GDK4|GUN_CRYAT	7.00e-40	33	243	25	225	Endoglucanase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1
sp|P45699|GUNK_FUSOX	2.07e-31	24	260	12	241	Putative endoglucanase type K OS=Fusarium oxysporum OX=5507 PE=2 SV=1
sp|O97401|GUN_PHACE	1.03e-30	33	237	43	240	Endoglucanase OS=Phaedon cochleariae OX=80249 PE=2 SV=1
sp|P43316|GUN5_HUMIN	5.55e-29	33	242	6	204	Endoglucanase-5 OS=Humicola insolens OX=34413 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000255	0.999719	CS pos: 29-30. Pr: 0.9703

TMHMM  Annotations     

There is no transmembrane helices in sr10982-t26_1-p1.