CAZyme Information: sr10799-t26_1-p1

Basic Information

• Species: Sporisorium reilianum
• Lineage: Basidiomycota; Ustilaginomycetes; ; Ustilaginaceae; Sporisorium; Sporisorium reilianum
• CAZyme ID: sr10799-t26_1-p1
• CAZy Family: AA5
• CAZyme Description: related to trehalase precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
792		86022.76	4.3476

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SreilianumSRZ2	6791	999809	118	6673

• Gene Location: location=FQ311470:518087-520465(-)

Full Sequence      

MRLPVYKSLVALLPALAAVAAQDTSSASAPSTSTGMVSSLASSASSAASSSSITTSSSSV
TSSSASSSVNPLTEKPPAAVPSATTTPTAFIPTGPLPPEQELCTSPIYCPGPLLQAVQLA
GIFKDSKTFVDKATSKPESVVVDNFNQLGGGNASNITYDELIQFVDDNFVAEGVELVPAD
LGSEFVTDPEFLRGVEDEVVRDWLKQVHSYWELLARTTNSSSPSGVQCDGCVSSFIPFNE
SRVFVVPGGRFRELYYWDTFFVIEGLITSQLQSVVKAILENFGDLIDRLGFIPNGNRVYY
ENRSQPPFFTLMIDKYIQAYNDTSVLQRFLPLLEREMSYWKTNRTIEFTSPFTNTTHNIT
HYKVDTSAPRPESYLEDYKTVQNASQSGLELNDTQRATLYSDIASGAESGSDYSAARWSK
RPTINLTDTIPAQRFLNTAAQLPVDLNAILFACEQKLSAFYKISGNGTQANATRANYWAQ
QAQARKEAILDVFWDPSKKFFYDFNTTLGERAPFFTPAGFFPLWAQILPQEFVNESISLD
QRRQNLQGVFSGLRYIIDRFNGTLPASLVTTGQQWDFANAWPPHTYIALEALRNLPDMLA
AGPQLPAENGTFALIPTVNGTNQLGQTEDSLPVQGFENEPGSSINETLAGATDPNNASVE
LHPSLNTGNNTSGESWRDELVRELANRYVASALCSWRATGGKLNTTDPAFQPVPDATLTA
NGLNASTAIGNMFEKFNASDINAAGSGGEYTVQTGFGWTNGVAIWLGGQLGANLTRPECP
PVIAQNVTADEE

Enzyme Prediction     

EC	3.2.1.28:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	122	597	7.5e-118	0.869653767820774

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395961	Trehalase	2.75e-122	122	764	2	502	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
215307	PLN02567	3.36e-102	108	777	13	551	alpha,alpha-trehalase
224541	TreA	5.65e-73	105	600	53	492	Neutral trehalase [Carbohydrate transport and metabolism].
237326	treA	4.17e-61	92	594	38	470	alpha,alpha-trehalase TreA.
183936	treA	5.29e-59	78	593	26	469	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBQ72773.1|GH37	0.0	1	792	1	792
SJX62605.1|GH37	0.0	1	792	1	798
CDU25958.1|GH37	0.0	1	792	1	808
SAM83085.1|GH37	0.0	1	792	1	756
BCI56844.1|GH37	1.95e-187	82	783	40	712

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z66_A	5.11e-53	104	594	45	473	Structure of periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]
2JG0_A	2.45e-51	111	594	15	436	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
7E9U_A	3.08e-50	125	764	40	548	Chain A, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
7E9X_A	3.67e-49	125	764	40	548	Chain A, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]
2JF4_A	6.74e-49	111	594	15	436	Family 37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54QZ5|TREA_DICDI	1.31e-103	103	779	49	594	Trehalase OS=Dictyostelium discoideum OX=44689 GN=treh PE=3 SV=1
sp|Q8MMG9|TREA_PIMHY	1.45e-89	98	762	40	563	Trehalase OS=Pimpla hypochondriaca OX=135724 GN=tre1 PE=1 SV=1
sp|P32359|TREA_TENMO	1.44e-86	99	764	21	546	Trehalase OS=Tenebrio molitor OX=7067 PE=2 SV=1
sp|Q9JLT2|TREA_MOUSE	7.38e-82	96	775	21	552	Trehalase OS=Mus musculus OX=10090 GN=Treh PE=1 SV=1
sp|A8J4S9|TREA_APIME	3.43e-81	103	778	41	576	Trehalase OS=Apis mellifera OX=7460 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000447	0.999517	CS pos: 21-22. Pr: 0.9127

TMHMM  Annotations     

There is no transmembrane helices in sr10799-t26_1-p1.