CAZyme Information: sr10711.2-t26_1-p1

Basic Information

• Species: Sporisorium reilianum
• Lineage: Basidiomycota; Ustilaginomycetes; ; Ustilaginaceae; Sporisorium; Sporisorium reilianum
• CAZyme ID: sr10711.2-t26_1-p1
• CAZy Family: AA3
• CAZyme Description: related to Mannosyl-oligosaccharide alpha-1,2-mannosidase precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
588		64448.82	6.9003

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SreilianumSRZ2	6791	999809	118	6673

• Gene Location: location=FQ311452:1363789-1365558(-)

Full Sequence      

MLAKPFGALLVALLSVGLPSAVDAATIQKPGLTQSATSKARADQIKAAYRTSYEAHLKYA
SGHDALLPLSNGFEDPFGGWGASVVDSLSTSFLMGHMDLYDQGVEFSKRIDFTKTASSSI
SLFETNIRYLGGLISAYELGGKKEHKLIEQAKVVGDHLITGWVGHDNPLPCNTLKWNDLA
PADACTSAGIAEAGTLILEMDRLSKYTGDAKYLEHATKSMKAIAQSKGVFPGLFAQVYDP
RTGEPVDDYVTWGGGSDSFFEYLIKYAYLTGDDESLWIPTWVNSVSSSIQHLVQHPEQTQ
QMQLMYLTDYSASHGGNLPRWSHLGCFAGGNWLLGSKMIGQAAFEGYGLALTAACANTYS
SSPSGIGPESFVFVGRGNNTNGVQINDRAFYRQHGFDFEVTQYVLRPEVMESVFYAYRTT
GDEKWQEIAWNAWTSIYRHCLVKQNGALAALANVNATNPTQLDDSESFVYAETFKYLFLT
FADPQLASLDRFVFNTEAHPFLVDKPDKASYKAKVVDLPVQRRPTPSKTSAPGKAAKDVP
MPAFSGLPGLQLPKDGRVNTLGNMLGWLKRGAGVRRHARGMRRQVREE

Enzyme Prediction     

No EC number prediction in sr10711.2-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	50	502	6.6e-115	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	1.13e-155	48	503	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	3.00e-105	37	507	68	522	glycoside hydrolase family 47 protein; Provisional
224250	YyaL	1.59e-05	115	234	459	582	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBQ72197.1|GH47	0.0	1	588	1	588
SJX62068.1|GH47	0.0	1	588	1	589
AME15770.1|GH47	0.0	1	588	1	587
CDS82437.1|GH47	0.0	1	588	1	587
SAM81348.1|GH47	4.54e-305	1	518	1	513

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1HCU_A	7.34e-86	41	503	15	492	Chain A, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_B Chain B, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_C Chain C, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_D Chain D, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei]
2RI8_A	1.86e-85	37	503	1	473	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]
1KKT_A	4.96e-85	37	503	36	508	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]
1NXC_A	9.08e-51	36	514	15	476	Structure of mouse Golgi alpha-1,2-mannosidase IA reveals the molecular basis for substrate specificity among Class I enzymes (family 47 glycosidases) [Mus musculus]
5KKB_A	2.78e-50	36	501	17	465	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0D076|MNS1B_ASPTN	6.39e-93	34	503	32	507	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mns1B PE=3 SV=1
sp|A2QAS2|MNS1B_ASPNC	6.16e-91	33	503	34	510	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mns1B PE=3 SV=1
sp|Q5BF93|MNS1B_EMENI	3.81e-90	38	506	30	504	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mns1B PE=2 SV=2
sp|A1CP08|MNS1B_ASPCL	1.75e-89	38	503	32	508	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mns1B PE=3 SV=1
sp|Q12563|MNS1B_ASPPH	3.66e-89	33	503	34	510	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus phoenicis OX=5063 GN=mns1B PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000281	0.999682	CS pos: 24-25. Pr: 0.9754

TMHMM  Annotations     

There is no transmembrane helices in sr10711.2-t26_1-p1.