CAZyme Information: sr10696-t26_1-p1

Basic Information

• Species: Sporisorium reilianum
• Lineage: Basidiomycota; Ustilaginomycetes; ; Ustilaginaceae; Sporisorium; Sporisorium reilianum
• CAZyme ID: sr10696-t26_1-p1
• CAZy Family: AA3
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
390		43562.66	5.8700

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SreilianumSRZ2	6791	999809	118	6673

• Gene Location: location=FQ311452:1339921-1341093(+)

Full Sequence      

MTTSQITLKLSATEASQLVDKLIHKLLHNEDSDGKFLLPLADGRIIDTKGWNGWEWTHGV
ALYALFEHHRLTSSTVPLDIIHTWFANRQAQGGTTKNINTMAALLSLACVYELDPQSHPE
YKAQLIEWAEWAMDGLPKTEEGGFQHITYDLENKGQLWDDTLMMTVLPLAKIGKVLQVER
YVQEAKYQFLLHIKYLYDAQTGLWFHGWTFEGRHHFAGAHWARGNCWITLAIPLLFHILG
AEDADVADHESFFARHLIGTLEAQLDALLPQQDRATGLWHTLLKHSDSYVESSATAGFTA
GTYLALRFGLIKDSAKKEAYARMADVALKGVVGMIAEDGELQQTSFGTAMGHDLDFYRKI
PITPMPYGQALALLAIVEKMALDGQASADA

Enzyme Prediction     

No EC number prediction in sr10696-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	50	378	6.3e-91	0.963855421686747

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	1.06e-84	19	381	1	351	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	1.26e-78	30	378	3	338	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBQ72185.1|GH105	1.13e-293	1	390	1	390
SJX62056.1|GH105	1.80e-290	1	390	1	390
CDS82403.1|GH105	4.65e-256	1	389	1	387
SAM81338.1|GH105	5.24e-232	1	382	1	381
CDI52814.1|GH105	1.22e-228	1	382	1	382

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XUV_A	5.25e-127	11	378	4	367	Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3QWT_A	5.15e-124	14	378	25	375	Chain A, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	1.98e-121	10	378	22	376	Chain A, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3K11_A	1.43e-13	180	362	224	392	Crystal structure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4WU0_A	4.65e-09	120	320	94	295	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O31521|URHG1_BACSU	1.13e-38	54	378	29	334	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000032	0.000000

TMHMM  Annotations     

There is no transmembrane helices in sr10696-t26_1-p1.