CAZyme Information: sr10693-t26_1-p1

Basic Information

• Species: Sporisorium reilianum
• Lineage: Basidiomycota; Ustilaginomycetes; ; Ustilaginaceae; Sporisorium; Sporisorium reilianum
• CAZyme ID: sr10693-t26_1-p1
• CAZy Family: AA3
• CAZyme Description: related to alpha-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
869	FQ311452|CGC3	96643.17	6.4345

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SreilianumSRZ2	6791	999809	118	6673

• Gene Location: location=FQ311452:1328859-1331468(-)

Full Sequence      

MLVERPLTNLTPAGQQPANAFKLTNAQGFEWTLSFLTPTILKLVVVGPNHPLPQQSNVQW
TQKPLALSSKIDAAAKKATLTVEGLTREVTVQFDDTPLVDVHERVQGSNDKVHIFGDLPH
KSYCYSNEGFMRYTRFQKDNLHVGLGEKAAPLDLTHRSFAITGSDSASYDAYLTDPLYKH
TPFLMSLPKPFDVEGNPQPLCSVVGIYSASNSDGNWDVGRFIDEPWGIFKRYGQDYGGIE
EYVIIGEQAQDVVTQFSDLVSRPLLVPRDWLGYLASGMGLGESDMPIAQELLSGFPGTCK
QHDIPCSAIHLSSGYTVDNEGNRLVFTMNTRRYPDFAEMVKTFHKAGIRVTPNIKPYVMQ
SHPHYQKLYEAGALFTDPNNDNKPVVTRIWSSGIGCTALGSWVDLTSKAGRDWWRQGALE
LCKLGVDSLWNDNNEYLLFDSDYICKNELVGDAKVDGNRTSKPTAVGALGRMTNTELMAR
ESYEALVTHHPDRRPFVLTRSANVGTQKWAASTWSGDNRTSWHNLRGSIAMNLNAQMSLL
QSYGNDIGGFAGPLPSPELFVRWIQSGVTQPRFCIHSFKPCKEDPAGVKLNNLPWMYPEV
VDIIRSTIKRRYEMLPFINNLNWRSHVAAEPMNTWLGWGEFAADPEVYRKEVLEGFDYWI
GHGQLLVAGAYHENEQTRRVYLPAAGKQDTKVYYDTHAPFTVYKAGQWVDNVSTPLSHFA
VFAREGTVVPVGLPKVTLTQSEGIATLTGSGTKILTEQEGGQCVHDDWRGIEVFPSPADA
SSPSQYTYTWIEDDGVSAKPVTAEVKVDISSSKDEVSVKATATKNDFKPLWGNTLWVILP
RPDTRKVQGATKTMLYKGQTAYAISVAGL

Enzyme Prediction     

No EC number prediction in sr10693-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	242	729	1.8e-96	0.9953161592505855

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
269885	GH31_glycosidase_Aec37	2.44e-164	262	608	2	319	E.coli Aec37-like. Glycosyl hydrolase family 31 (GH31) domain of a bacterial protein family represented by Escherichia coli protein Aec37. The gene encoding Aec37 (aec-37) is located within a genomic island (AGI-3) isolated from the extraintestinal avian pathogenic Escherichia coli strain BEN2908. The function of Aec37 and its orthologs is unknown; however, deletion of a region of the genome that includes aec-37 affects the assimilation of seven carbohydrates, decreases growth rate of the strain in minimal medium containing galacturonate or trehalose, and attenuates the virulence of E. coli BEN2908 in chickens. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
395838	Glyco_hydro_31	1.30e-99	242	729	1	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
224418	YicI	1.21e-96	131	853	144	761	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
269890	GH31_glucosidase_II_MalA	4.91e-67	262	626	2	336	Alpha-glucosidase II-like. Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities. Alpha-glucosidase II has been characterized in Bacillus thermoamyloliquefaciens where it forms a homohexamer. This subgroup also includes the MalA alpha-glucosidase from Sulfolobus solfataricus and the AglA alpha-glucosidase from Picrophilus torridus. MalA is part of the carbohydrate-metabolizing machinery that allows this organism to utilize carbohydrates, such as maltose, as the sole carbon and energy source.
269889	GH31_GANC_GANAB_alpha	3.40e-54	301	730	35	427	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBQ72182.1|GH31	0.0	1	869	1	869
SJX62053.1|GH31	0.0	1	869	1	869
CDS82393.1|GH31	0.0	1	869	1	869
SAM81322.1|GH31	0.0	1	869	1	868
CDI52820.1|GH31	0.0	1	869	1	868

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4B9Y_A	1.33e-26	210	632	207	588	Crystal Structure of Apo Agd31B, alpha-transglucosylase in Glycoside Hydrolase Family 31 [Cellvibrio japonicus],4B9Z_A Crystal Structure of Agd31B, alpha-transglucosylase, complexed with Acarbose [Cellvibrio japonicus],4BA0_A Crystal Structure of Agd31B, alpha-transglucosylase, complexed with 5F-alpha-GlcF [Cellvibrio japonicus]
5I23_A	1.38e-26	210	632	184	565	Crystal Structure of Agd31B, alpha-transglucosylase in Glycoside Hydrolase Family 31, in complex with Cyclophellitol Aziridine probe CF022 [Cellvibrio japonicus Ueda107],5I24_A Crystal Structure of Agd31B, alpha-transglucosylase in Glycoside Hydrolase Family 31, in complex with Cyclophellitol Aziridine probe CF021 [Cellvibrio japonicus Ueda107],5NPB_A Crystal Structure of cjAgd31B (alpha-transglucosylase from Glycoside Hydrolase Family 31) in complex with alpha Cyclophellitol Cyclosulfate probe ME647 [Cellvibrio japonicus],5NPE_A Crystal Structure of cjAgd31B (alpha-transglucosylase from Glycoside Hydrolase Family 31) in complex with beta Cyclophellitol Aziridine probe KY358 [Cellvibrio japonicus Ueda107]
5DJW_A	2.26e-26	144	621	66	497	Crystal structure of Family 31 alpha-glucosidase (BT_3299) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5DJW_B Crystal structure of Family 31 alpha-glucosidase (BT_3299) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
5NPC_A	5.49e-26	210	632	183	564	Crystal Structure of D412N nucleophile mutant cjAgd31B (alpha-transglucosylase from Glycoside Hydrolase Family 31) in complex with unreacted alpha Cyclophellitol Cyclosulfate probe ME647 [Cellvibrio japonicus],5NPD_A Crystal Structure of D412N nucleophile mutant cjAgd31B (alpha-transglucosylase from Glycoside Hydrolase Family 31) in complex with alpha Cyclophellitol Aziridine probe CF021 [Cellvibrio japonicus]
5NN4_A	1.01e-25	237	773	254	787	Crystal structure of human lysosomal acid-alpha-glucosidase, GAA, in complex with N-acetyl-cysteine [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9F234|AGL2_BACTQ	1.71e-40	70	732	81	677	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
sp|Q8TET4|GANC_HUMAN	5.28e-35	237	772	329	822	Neutral alpha-glucosidase C OS=Homo sapiens OX=9606 GN=GANC PE=2 SV=3
sp|Q9BE70|GANC_MACFA	2.42e-34	237	772	184	677	Neutral alpha-glucosidase C (Fragment) OS=Macaca fascicularis OX=9541 GN=GANC PE=2 SV=2
sp|Q8BVW0|GANC_MOUSE	1.46e-33	237	743	313	774	Neutral alpha-glucosidase C OS=Mus musculus OX=10090 GN=Ganc PE=1 SV=2
sp|Q14697|GANAB_HUMAN	1.38e-31	139	730	264	811	Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998991	0.001039

TMHMM  Annotations     

There is no transmembrane helices in sr10693-t26_1-p1.