CAZyme Information: sr10039-t26_1-p1

Basic Information

• Species: Sporisorium reilianum
• Lineage: Basidiomycota; Ustilaginomycetes; ; Ustilaginaceae; Sporisorium; Sporisorium reilianum
• CAZyme ID: sr10039-t26_1-p1
• CAZy Family: AA1
• CAZyme Description: probable oligosaccharyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
797		87693.33	8.8630

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SreilianumSRZ2	6791	999809	118	6673

Full Sequence      

MSAGTSSKAGASPGQAGTRTAYRLPTLSAESNNNVLSLLRLIIIFLIAGAAVSSRLFAVV
RHESIIHEFDPWFNFRATKVLTTDGFYRFWNWFDATAWYPLGRAAGGTAYPGLMVTSGAI
FNLFHSLNIPVDIRNICVLLAPAFSGLTAWATYMFTAAMKDDAAGLLAAAFIGIAPGYIS
RSVAGSYDNEAIAIFLLMMTFYLWIKALKDGSALWGVATALFYFYMVAAWGGYVFITNMI
PLHALVLILMGRFSSRLYVSYSSFYALGTLASMQVPFVGFQPVRTSEHMAALGVFGLLQL
VAFVELVRSHVPSKQFKLLLVAFVVLVATLAFGALVALTYAGYVAPWTGRFYSLWDTAYA
KKHIPIIASVSEHQPPAWPAFFFDLEMLIFLFPVGVFLLFKELRDEHVFVIIYAVMASYF
AGVMVRLMLTLTPVVCVSAAIAMSTLLQTYLDPKEPTPLVAGKGDAEEDDGAVAKSTRAA
TAASRKAAEVGSSDSELSRPASPVFGASSFSSSKFGVFGLDSRFFVTIYSLLLLLVFVLH
CTFVTSTAYSSPSVVLASRNADGSQHIIDDFREAYYWLRQNTASDAKVMSWWDYGYQISG
MADRPTLVDNNTWNNTHIATVGKAMCSTEERSYPILRKHDVDYVLIIFGGLLGFSGDDIN
KYLWMIRIAQGVWPDEVREADYFTPQGQYKVDDGASKTMRESLLYKMSYYRFNDLFGGRP
GMDRVRQTPGPTKSPELDHLDEAFTSENWIVRIYQVKKPDALGRDLPGVKAFEGGKRRKR
AVALPAAPATAGAGGRK

Enzyme Prediction     

EC	2.4.99.18:21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT66	38	713	9.9e-184	0.8513708513708513

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396873	STT3	7.94e-133	48	455	11	421	Oligosaccharyl transferase STT3 subunit. This family consists of the oligosaccharyl transferase STT3 subunit and related proteins. The STT3 subunit is part of the oligosaccharyl transferase (OTase) complex of proteins and is required for its activity. In eukaryotes, OTase transfers a lipid-linked core-oligosaccharide to selected asparagine residues in the ER. In the archaea STT3 occurs alone, rather than in an OTase complex, and is required for N-glycosylation of asparagines.
224206	Stt3	3.68e-94	48	778	28	751	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].
275016	archaeo_STT3	3.01e-17	68	605	32	547	oligosaccharyl transferase, archaeosortase A system-associated. Members of this protein family occur, one to three members per genome, in the same species of Euryarchaeota as contain the predicted protein-sorting enzyme archaeosortase (TIGR04125) and its cognate protein-sorting signal PGF-CTERM (TIGR04126).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBQ70063.1|GT66	CBQ70063.1|GT66	0.0	1	797	1	797
SJX65712.1|GT66	SJX65712.1|GT66	0.0	1	797	1	797
CDS81882.1|GT66	CDS81882.1|GT66	0.0	1	796	1	790
SAM85545.1|GT66	SAM85545.1|GT66	0.0	18	791	13	793
CDI56118.1|GT66	CDI56118.1|GT66	0.0	19	797	14	799

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6C26_A	6C26_A	2.05e-305	37	769	14	695	The Cryo-EM structure of a eukaryotic oligosaccharyl transferase complex [Saccharomyces cerevisiae S288C],6EZN_F Cryo-EM structure of the yeast oligosaccharyltransferase (OST) complex [Saccharomyces cerevisiae S288C],7OCI_F Chain F, Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 [Saccharomyces cerevisiae S288C]
6S7T_A	6S7T_A	9.12e-284	37	760	70	776	Cryo-EM structure of human oligosaccharyltransferase complex OST-B [Homo sapiens]
6FTG_5	6FTG_5	6.25e-256	37	763	16	701	Subtomogram average of OST-containing ribosome-translocon complexes from canine rough microsomal membranes [Canis lupus familiaris],6FTI_5 Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Programmed 80S Ribosome [Canis lupus familiaris]
6S7O_A	6S7O_A	6.25e-256	37	763	16	701	Cryo-EM structure of human oligosaccharyltransferase complex OST-A [Homo sapiens]
6FTJ_5	6FTJ_5	1.84e-255	37	757	16	695	Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Non-programmed 80S Ribosome [Canis lupus familiaris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94335|STT3_SCHPO	sp|O94335|STT3_SCHPO	0.0	39	779	24	738	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit stt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=stt3 PE=3 SV=1
sp|P39007|STT3_YEAST	sp|P39007|STT3_YEAST	1.05e-304	37	769	14	695	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=STT3 PE=1 SV=2
sp|E2RG47|STT3B_CANLF	sp|E2RG47|STT3B_CANLF	3.31e-283	37	760	70	776	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Canis lupus familiaris OX=9615 GN=STT3B PE=1 SV=1
sp|Q8TCJ2|STT3B_HUMAN	sp|Q8TCJ2|STT3B_HUMAN	4.69e-283	37	760	70	776	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Homo sapiens OX=9606 GN=STT3B PE=1 SV=1
sp|Q3TDQ1|STT3B_MOUSE	sp|Q3TDQ1|STT3B_MOUSE	5.99e-283	37	760	67	773	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Mus musculus OX=10090 GN=Stt3b PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000001	0.000038

TMHMM  Annotations     

Start	End
36	58
107	129
136	158
162	184
191	208
228	250
257	279
289	311
318	340
378	400
407	429
522	544