CAZyme Information: sr00094.2-t26_1-p1

Basic Information

• Species: Sporisorium reilianum
• Lineage: Basidiomycota; Ustilaginomycetes; ; Ustilaginaceae; Sporisorium; Sporisorium reilianum
• CAZyme ID: sr00094.2-t26_1-p1
• CAZy Family: AA1
• CAZyme Description: related to 6-hydroxy-D-nicotine oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
587		63994.30	7.2416

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SreilianumSRZ2	6791	999809	118	6673

Full Sequence      

MRLAALYRLVLGASTLFSVARASHAPNDNTTILQPRVVAATRLQRCLGEAGIEVVAADVS
TAEVYFQASASDNVVFHYNPTLIAYPSSASLVQQAVVCVSEHSDAPIAARSGGHSFAGFG
SGGMDGSVVIDLARLNSVVSHPQSGTVEVGPGARLGDVVKGLWHQGNGQRAMSTGTCAAV
GVGGLSLCGGFGPMSRKWGLTTDSILEADLVLANGSMVTVSESQHPELLWALRGSGSFFG
IVTRFLFRSQDASPPVISFEYRWTPSIDSLDKTIAVIMAVQAFSLQPSLSNDLGLHIQLR
RPSHGDPQPSANRPISIEVKGIYLGPVAEWDKLQSALKGELRSRSAPRADVEKVSLRTYL
ELMEEWDDFGKGEHKLDTEAIHKQHNNFVTKSSLTLEPNKGFDEQALRPLFQYLWDTSLS
AGQDVNLPNGKHVFWGWNIYFELFGGGTPAHAQPKAKKLSSFPHRDGLWLIQVAVGTVSY
MDLAHSGHVYARELDARVNGAIEASGLGRGGYSCYVDSDLNEDEWKQLYYGDSIPRLEEI
KMQLDPQNLFRNPQTLGSRRDIQARRKAARRRRRRGQPMDTDSLLIA

Enzyme Prediction     

EC	1.1.3.-:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	73	554	4.4e-81	0.9781659388646288

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223354	GlcD	1.04e-28	51	553	7	452	FAD/FMN-containing dehydrogenase [Energy production and conversion].
396238	FAD_binding_4	9.37e-27	80	221	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
369658	BBE	2.14e-08	519	554	7	42	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
215242	PLN02441	8.86e-08	68	244	52	233	cytokinin dehydrogenase
178402	PLN02805	1.23e-04	63	250	116	305	D-lactate dehydrogenase [cytochrome]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRC92907.1|AA7	QRC92907.1|AA7	1.39e-59	46	558	32	492
QRW27390.1|AA7	QRW27390.1|AA7	7.41e-57	65	557	51	491
QRW15212.1|AA7	QRW15212.1|AA7	1.95e-56	59	557	44	490
QRV86657.1|AA7	QRV86657.1|AA7	1.95e-56	59	557	44	490
QRW00715.1|AA7	QRW00715.1|AA7	3.77e-56	59	557	44	490

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Y0R_AAA	6Y0R_AAA	4.67e-53	46	556	30	488	Chain AAA, Chitooligosaccharide oxidase [Fusarium graminearum PH-1]
5K8E_A	5K8E_A	1.38e-52	78	556	59	492	Xylooligosaccharide oxidase from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],5L6F_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylobiose [Thermothelomyces thermophilus ATCC 42464],5L6G_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylose [Thermothelomyces thermophilus ATCC 42464]
6YJO_A	6YJO_A	1.74e-50	9	554	9	499	Chain A, FAD-binding PCMH-type domain-containing protein [Fusarium graminearum PH-1]
3RJ8_A	3RJ8_A	2.92e-43	43	556	3	469	Crystal structure of carbohydrate oxidase from Microdochium nivale [Microdochium nivale],3RJA_A Crystal structure of carbohydrate oxidase from Microdochium nivale in complex with substrate analogue [Microdochium nivale]
6EO5_A	6EO5_A	4.13e-42	36	556	7	468	Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens],6EO5_B Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P9WEY2|DPMAF_METAN	sp|P9WEY2|DPMAF_METAN	2.56e-55	46	556	32	489	FAD-linked oxidoreductase dpmaF OS=Metarhizium anisopliae OX=5530 GN=dpmaF PE=1 SV=1
sp|E9F5F1|SUBF_METRA	sp|E9F5F1|SUBF_METRA	4.93e-55	46	586	32	509	FAD-linked oxidoreductase subF OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=subF PE=3 SV=1
sp|I1S2K2|CHITO_GIBZE	sp|I1S2K2|CHITO_GIBZE	2.40e-52	46	556	30	488	Chitooligosaccharide oxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=chitO PE=1 SV=1
sp|G2QG48|XYLO_MYCTT	sp|G2QG48|XYLO_MYCTT	7.07e-52	78	556	59	492	Xylooligosaccharide oxidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=xylO PE=1 SV=1
sp|I1SB12|MNCO_MICNN	sp|I1SB12|MNCO_MICNN	2.20e-42	43	556	25	491	Carbohydrate oxidase OS=Microdochium nivale OX=5520 GN=MnCO PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000342	0.999609	CS pos: 22-23. Pr: 0.9707

TMHMM  Annotations     

There is no transmembrane helices in sr00094.2-t26_1-p1.