CAZyme Information: mRNA_M_BR32_EuGene_00147431-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00147431-p1
• CAZy Family: PL26
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
405		47048.10	10.8985

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00076:6749-8344(-)

Full Sequence      

SNNLPIYKNPTYCVDDRVKDFIKRIIIEKKAGQFFQTIIFQGPRGIFNKRGEKRNSTENI
ITEKLIIYFNIANKIINVKEIAQFFVQIAREKYRAVGIRAVLHPQINVATEPKWNSHFAY
GKNQIYSGNNFKYYFIFFKTIIAAGTRQIIPYYLRPFGTKYNPVGFFFNKQIVIYLLKEK
FGFKGIIFSNWGLITDIVILGQNIPARAWGVQHLSEFDRALRIFDAGVNQFGGEARPKLV
VQLVKKGNVSESRIDVSVKRLFREKFFLGFFENLFVDPKTVRSIVGNDYFVRFGQNAQRK
TYIFFINKNKLLPFKKPRVNISIKFYIKGFNVTTLEKRNFLVAFYEPRSGGFEFRFHIGS
LEFNAIKKARQTTIYKTVPTVVNIILNRLTVIFKVVKGAVAVFGN

Enzyme Prediction     

EC	3.2.1.21:5	3.2.1.38:1	3.2.1.-:1

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395747	Glyco_hydro_3	2.91e-07	169	263	233	315	Glycosyl hydrolase family 3 N terminal domain.
185053	PRK15098	0.001	176	316	273	409	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ66666.1|GH3	9.62e-190	1	405	36	567
QBZ61755.1|GH3	7.70e-137	4	405	40	562
UQC87911.1|GH3	6.92e-133	1	405	37	573
AUM60063.1|GH3	5.22e-132	7	405	51	576
QRD86843.1|GH3	1.49e-128	2	405	37	565

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	5.43e-06	162	339	264	429	Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
1LQ2_A	8.70e-06	138	322	238	416	Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with gluco-phenylimidazole [Hordeum vulgare],1X38_A crystal structure of barley beta-D-glucan glucohydrolase isoenzyme exo1 in complex with gluco-phenylimidazole [Hordeum vulgare],1X39_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme exo1 in complex with gluco-phenylimidazole [Hordeum vulgare]
1EX1_A	8.72e-06	138	322	238	416	Beta-d-glucan Exohydrolase From Barley [Hordeum vulgare],1IEQ_A Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase Isoenzyme Exo1 [Hordeum vulgare],1IEV_A Crystal Structure Of Barley Beta-d-glucan Glucohydrolase Isoenzyme Exo1 In Complex With Cyclohexitol [Hordeum vulgare],1IEW_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with 2-deoxy-2-fluoro-alpha-D-glucoside [Hordeum vulgare],1IEX_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with 4I,4III,4V-S-trithiocellohexaose [Hordeum vulgare],1J8V_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with 4'-nitrophenyl 3I-thiolaminaritrioside [Hordeum vulgare],3WLH_A Crystal Structure Analysis of Plant Exohydrolase [Hordeum vulgare subsp. vulgare],3WLJ_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme EXO1 in complex with 3-deoxy-glucose [Hordeum vulgare subsp. vulgare],3WLK_X Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme EXO1 in complex with 4-deoxy-glucose [Hordeum vulgare subsp. vulgare],3WLL_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme EXO1 in complex with PEG400 [Hordeum vulgare subsp. vulgare],3WLM_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme exo1 in complex with octyl-O-glucoside [Hordeum vulgare subsp. vulgare],3WLN_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme EXO1 in complex with octyl-S-glucoside [Hordeum vulgare subsp. vulgare],3WLP_A Crystal Structure Analysis of Plant Exohydrolase [Hordeum vulgare subsp. vulgare]
3WLI_A	8.74e-06	138	322	242	420	Crystal Structure Analysis of Plant Exohydrolase [Hordeum vulgare subsp. vulgare],3WLO_A Crystal Structure Analysis of Plant Exohydrolase [Hordeum vulgare subsp. vulgare],6JG1_A Chain A, Barley exohydrolase I [Hordeum vulgare subsp. vulgare],6JG2_A Chain A, Barley exohydrolase I [Hordeum vulgare subsp. vulgare],6MD6_A CRYSTAL STRUCTURE ANALYSIS OF PLANT EXOHYDROLASE IN COMPLEX WITH METHYL 2-THIO-BETA-SOPHOROSIDE [Hordeum vulgare subsp. vulgare]
3WLQ_A	8.74e-06	138	322	242	420	Crystal Structure Analysis of Plant Exohydrolase [Hordeum vulgare subsp. vulgare],3WLR_A Crystal Structure Analysis of Plant Exohydrolase [Hordeum vulgare subsp. vulgare],6MI1_A CRYSTAL STRUCTURE ANALYSIS OF THE VARIANT PLANT EXOHYDROLASE ARG158ALA-GLU161ALA IN COMPLEX WITH METHYL 6-THIO-BETA-GENTIOBIOSIDE [Hordeum vulgare subsp. vulgare]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8NGU6|BGLC_ASPFN	2.64e-129	2	405	37	565	Probable beta-glucosidase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglC PE=3 SV=1
sp|Q2UFP8|BGLC_ASPOR	4.22e-126	1	405	40	569	Probable beta-glucosidase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglC PE=3 SV=2
sp|Q5BCC6|BGLC_EMENI	2.68e-119	4	405	35	558	Beta-glucosidase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglC PE=1 SV=1
sp|Q46684|BGLX_DICCH	2.47e-31	79	405	190	597	Periplasmic beta-glucosidase/beta-xylosidase OS=Dickeya chrysanthemi OX=556 GN=bgxA PE=3 SV=1
sp|T2KMH9|PLH34_FORAG	1.52e-09	117	316	232	429	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000063	0.000000

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00147431-p1.