CAZyme Information: mRNA_M_BR32_EuGene_00137631-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00137631-p1
• CAZy Family: PL20
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
329		37730.04	7.9108

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00032:89087-90232(+)

Full Sequence      

MHGIADSKSMSSLCNHALQHAIRPRYRTRLLTGLSMVVLITCLLLYSTLILQRPGSPDHG
FTRQKDRNWDDVSAKYDWVKPHQDHLIPQSIWQIILPRVWVGSNGGKDFVNRYFGYDEAI
VSTFNSLPNVGMKSDLLRYLLLYIKGGVYTDIDIVALKPIDDWVPRPFRNHTRLVVGIKF
DQRDGGRWADIVYTFQFCQWTITAAPGHPVFPMMISRVVQFWEDLKQKHNISSESPSWRP
TSFEVMNSTGPAAWTDVVWEYLQETDKGLTDMRDLSSLGTPTLFRDTFILPIDGFGMGQP
HSGSTNDGSIPDEAFARHLFRGLWRENQR

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00137631-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	4.90e-16	62	262	46	305	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.18e-10	92	166	18	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ58514.1|GT32	3.86e-189	47	329	63	372
QBZ59334.1|GT32	2.41e-145	3	325	10	360
QKX53490.1|GT32	5.77e-98	18	325	15	359
UKZ83874.1|GT32	2.18e-96	18	325	17	350
QYT06191.1|GT32	2.84e-94	18	325	17	350

PDB Hits     

mRNA_M_BR32_EuGene_00137631-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	3.04e-35	120	327	198	396	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	4.74e-30	76	327	93	378	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	9.55e-23	81	325	123	388	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	2.44e-20	109	327	145	472	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000009	0.000005

TMHMM  Annotations     

Start	End
30	52