CAZyme Information: mRNA_M_BR32_EuGene_00137561-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00137561-p1
• CAZy Family: GT31
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
240		28243.86	10.1727

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00032:63470-64192(+)

Full Sequence      

LHRYIRLIVHCYNYWTYKFKSIPIKPYYTADDVTVVIPTIHENFHEIRPLLESILATQPH
ELIIITTADKLDNLLRVSKAFFSPRIRVFCIQYANKRIQVCKALPKITTRITILADNDVT
WPSTILPWILAPFENTKIGGVGTCQRVKRVRKGGFGLRVWNWLGAAYIERRNFEISATHN
MDGGTFCMSGRTGAYRSEILRDYKFREGFMKEEWRGKILKADDNNFVSRWFVSYQWKTWI

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00137561-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	32	238	2.8e-20	0.8608695652173913

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133056	GT2_HAS	3.52e-79	32	240	1	204	Hyaluronan synthases catalyze polymerization of hyaluronan. Hyaluronan synthases (HASs) are bi-functional glycosyltransferases that catalyze polymerization of hyaluronan. HASs transfer both GlcUA and GlcNAc in beta-(1,3) and beta-(1,4) linkages, respectively to the hyaluronan chain using UDP-GlcNAc and UDP-GlcUA as substrates. HA is made as a free glycan, not attached to a protein or lipid. HASs do not need a primer for HA synthesis; they initiate HA biosynthesis de novo with only UDP-GlcNAc, UDP-GlcUA, and Mg2+. Hyaluronan (HA) is a linear heteropolysaccharide composed of (1-3)-linked beta-D-GlcUA-beta-D-GlcNAc disaccharide repeats. It can be found in vertebrates and a few microbes and is typically on the cell surface or in the extracellular space, but is also found inside mammalian cells. Hyaluronan has several physiochemical and biological functions such as space filling, lubrication, and providing a hydrated matrix through which cells can migrate.
404520	Glyco_tranf_2_3	3.03e-20	31	238	2	201	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
133045	CESA_like	8.68e-13	35	202	1	168	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
224136	BcsA	2.01e-05	4	202	25	228	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
99716	PB1	1.33e-04	24	90	3	80	The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster. Interactions of PB1 domains with other protein domains have been described as a noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, fungi, animals, and plants.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ55924.1|GT2	1.42e-148	1	240	41	280
QBZ58559.1|GT2	5.15e-126	20	240	220	443
QKD46914.1|GT2	1.48e-115	1	240	46	285
QGI90247.1|GT2	2.96e-115	1	240	46	285
QGI76547.1|GT2	2.96e-115	1	240	46	285

PDB Hits     

mRNA_M_BR32_EuGene_00137561-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G4MWY1|GT2_MAGO7	2.52e-149	1	240	41	280	Type 2 glycosyltransferase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=GT2 PE=1 SV=1
sp|I1RB03|GT2_GIBZE	2.73e-115	2	240	46	284	Type 2 glycosyltransferase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GT2 PE=2 SV=1
sp|F9WWD1|GT2_ZYMTI	3.58e-74	3	237	18	248	Type 2 glycosyltransferase OS=Zymoseptoria tritici (strain CBS 115943 / IPO323) OX=336722 GN=GT2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000071	0.000000

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00137561-p1.