CAZyme Information: mRNA_M_BR32_EuGene_00136951-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00136951-p1
• CAZy Family: GT31
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
446		48199.16	5.4065

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00031:121433-122832(-)

Full Sequence      

MTVNHNVPAQVDGMKHPYLVFAARPEHGHTYPILQIARDMIRRGFEATILTGEQYGEDII
KMGARPVTLPHYNPTPEALGELAKVTSKLQTLADSGNVALPGQQFIIVSDLAFTGQQPLV
RGAPLPKGFSVRPPVIHINVVPLAMPSIDTGPFGLGLPPDSSESGRARNKLLNAIYYGPD
GPYGPFGAEHIRLLKSLGATDIPSTVEAWGYTTSFPDITLQVCSPSLEFPRSDLPDNVHF
VGCLPRKPIGPDYEYPQWLKDIVSPTDGSARKKRIIGVAQGTIAVDYTDLIIPTIQGLAN
DDDVVVIALLGKKGATLPEGVTVPANARVVDYMPYEVVLNHADVWVANAGYGGFTQGVMH
GVPMVLAGDTQDKPDIAMIGEWSGVACNLRTGTPTPEQVAKGVREILSNDSYKARIVELQ
KENEAMNCLDAVEKHIWDAFAKMSDI

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00136951-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	100	440	7.7e-28	0.7879581151832461

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224732	YjiC	2.34e-32	14	422	2	381	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
340817	GT1_Gtf-like	1.38e-25	20	426	4	394	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
273616	MGT	1.16e-19	25	422	4	372	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
278624	UDPGT	4.54e-12	200	419	220	418	UDP-glucoronosyl and UDP-glucosyl transferase.
223071	egt	4.40e-04	319	437	340	459	ecdysteroid UDP-glucosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ53684.1|GT1	0.0	1	446	1	468
UQC81531.1|GT1	5.78e-163	15	438	119	556
QBZ53337.1|GT1	1.55e-156	15	434	14	451
UPK94024.1|GT1	5.93e-137	17	436	26	458
CEI63000.1|GT1	1.25e-132	7	436	12	454

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6J31_A	9.05e-16	18	436	6	394	Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]
6J32_A	9.22e-16	18	436	9	397	Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]
3OTG_A	5.68e-15	15	414	19	381	Crystal Structure of CalG1, Calicheamicin Glycostyltransferase, TDP bound form [Micromonospora echinospora],3OTH_A Crystal Structure of CalG1, Calicheamicin Glycostyltransferase, TDP and calicheamicin alpha3I bound form [Micromonospora echinospora],3OTH_B Crystal Structure of CalG1, Calicheamicin Glycostyltransferase, TDP and calicheamicin alpha3I bound form [Micromonospora echinospora]
4M83_A	1.37e-11	27	422	18	380	Ensemble refinement of protein crystal structure (2IYF) of macrolide glycosyltransferases OleD complexed with UDP and Erythromycin A [Streptomyces antibioticus],4M83_B Ensemble refinement of protein crystal structure (2IYF) of macrolide glycosyltransferases OleD complexed with UDP and Erythromycin A [Streptomyces antibioticus]
2IYF_A	5.71e-11	27	422	18	380	The crystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus],2IYF_B The crystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|J4VV61|GT1_BEAB2	1.11e-99	19	436	21	454	UDP-glucosyltransferase 1 OS=Beauveria bassiana (strain ARSEF 2860) OX=655819 GN=BBA_08686 PE=2 SV=1
sp|E7CQW6|UGTA1_STABO	1.50e-68	17	436	8	431	UDP-glucosyltransferase A1 OS=Starmerella bombicola OX=75736 GN=ugtA1 PE=1 SV=1
sp|E9L011|UGTB1_STABO	2.08e-62	17	436	6	427	UDP-glucosyltransferase B1 OS=Starmerella bombicola OX=75736 GN=ugtB1 PE=1 SV=1
sp|Q8KHE4|REBG_LENAE	6.50e-43	19	433	5	415	4'-demethylrebeccamycin synthase OS=Lentzea aerocolonigenes OX=68170 GN=rebG PE=1 SV=1
sp|Q53685|OLED_STRAT	3.08e-10	27	422	18	380	Oleandomycin glycosyltransferase OS=Streptomyces antibioticus OX=1890 GN=oleD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000065	0.000000

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00136951-p1.