CAZyme Information: mRNA_M_BR32_EuGene_00134571-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00134571-p1
• CAZy Family: GT22
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
717	BR32_scaffold00028|CGC2	76788.03	5.3438

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00028:176277-178428(-)

Full Sequence      

MARRTAHSCLLANVLAVQARVFTPSKVAVGTAPSQGGGPFAPFTLNASHPLATLDYGVEV
AGYPQLTVSDVSGGASVQVEVKYSEPFAGLEQVWADGPYTYQQGLANAFRVETFNVSAAG
LVASRLIQGGQRWQSVRLLDAGSSAAAVTFQSVGFEATAGEAAIADMPGKFSCDDEVLNE
VWALGARAADLACVERGTQKAVWQVDPDKGVRVASVRPTQTLRGALLGNYTLEFDAMIER
GGVWWSVAWPLGRFGGVQLQLTSELPNATTFSNTNTTLLPRNTLKLGWGFGFVNQTTLTS
YDLALAAVPFDVAENKWYHLTTTLSPDGFLSVSLDKTRILHTQLSQYYIGGSPIAPSGSF
GFGAWQDQAAWVRNVTATAQNGSVVYQNPMTSPEVLSEYGVQSNSEGVCLDGPKRDRLVW
LGDFLHTIRIMGASTSRFDLERGTLRFFLGTQIPLGIFDISPRMGYDPAAASGPFSGFGA
QPYALEDYQLLGLNALHSYVQQTGDLAFVRDGWAQWRRQFDWLFARVNQTTNLLNLESAF
LGPAVDGSATSCLAVQTLRAIADLSLAVGDDLFHSRANQTADEMARAVNARLWNDARGFY
SVSLADPDHLSVQATAFCLSSGVASDPRRISRSVAALDALQLGPGYKDSSLIDSTAPDTT
ISPNTNGFLLDGLLRRSSSSSSSSSSRNTSDAAARLLRSLWPEMLPGAHGDRHASGA

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00134571-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	396	628	3e-25	0.4305555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	3.88e-06	396	637	19	251	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
225942	GDB1	3.14e-05	437	608	301	476	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ61615.1|GH78	0.0	1	717	1	713
QMW40986.1|GH78	8.84e-223	22	706	26	689
QMW28911.1|GH78	8.84e-223	22	706	26	689
QRD85156.1|GH78	8.84e-223	22	706	26	689
QKD47609.1|GH78	1.55e-210	22	705	36	697

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XHC_A	4.19e-07	401	526	227	342	Chain A, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

mRNA_M_BR32_EuGene_00134571-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.603133	0.396879

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00134571-p1.