CAZyme Information: mRNA_M_BR32_EuGene_00134041-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00134041-p1
• CAZy Family: GT21
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
633	BR32_scaffold00028|CGC1	70392.28	7.6482

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00028:41787-43773(+)

Full Sequence      

MGILRSRKQQCFGIAIVAAICTLYLLGLWTGPGRPLDATVLITTQHNPSSPSSSTTPTKH
AVPDDTVSTTQPAGRGPKPAPPGQHPVSYLIGAAEAEMKTTLARQSKTLRDAVAEYRRRH
DGLPPPPNFDKWWEFARARDVQLVDEFDGVADLLAPFWGLRPATIRGRAAEALGFAGNLL
LGVQVRAGKIAHISGGNDWHRKALSGMMASFVEHLPDMDLAFNVHDEPRVVVPHDDMARL
VARAAEEKAAAAAGKKPRNSFAPSGGEVRPAGLAPEGGFDAVGTTRFNTYAHQSSWLHSR
ASCAPGSAARILDDSERVDDVSQSLMGELGFVYNATALSDVCASPSLATSFGLFERPNAY
SVVQELFPIFSASKVSSYADILHPAPWYWYEKVAYDEAQDPNWESKKAKMYWRGSTTGGY
SRNGGWKRHHRQRMVDKLSNGDSAKILEPVEARDASQQHQLTWQAKPASRSRLASLFDVF
FSHVGQCDPADCDEQERHFTVKGRTRPESAWHYRHLLDVDGNAFSGRFYAFLQSRSLVYK
LSIFREWHADWLKPWVHYVPMSLRGDDWAELVRYFSQGGADGGDELAEKMALRGREWAAK
VLRNEDLEVWFFRLLLEYGRVVDDDRKNIGYLP

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00134041-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	345	622	1.5e-80	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	9.33e-21	368	620	32	251	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	1.63e-11	368	620	108	321	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ61568.1|GT90	0.0	1	633	1	633
EAA28085.1|GT90	1.14e-241	75	633	62	619
UQC78507.1|GT90	1.68e-238	83	631	73	608
APA08219.1|GT90	2.14e-234	46	631	77	652
QSZ35850.1|GT90	4.93e-234	35	631	79	659

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	3.34e-09	345	620	95	340	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]
5F84_A	4.80e-07	368	627	154	384	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	1.24e-52	85	628	152	662	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q16QY8|RUMI_AEDAE	5.66e-15	364	628	159	394	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|B0X1Q4|RUMI_CULQU	2.31e-11	360	628	156	395	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|A0NDG6|RUMI_ANOGA	9.41e-11	364	622	159	386	O-glucosyltransferase rumi homolog OS=Anopheles gambiae OX=7165 GN=AGAP004267 PE=3 SV=1
sp|G3V9D0|PGLT1_RAT	8.85e-10	345	620	123	368	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000030	0.000001

TMHMM  Annotations     

Start	End
12	31