CAZyme Information: mRNA_M_BR32_EuGene_00133671-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00133671-p1
• CAZy Family: GT20
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
541		58273.26	5.1723

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00027:219241-221587(-)

Full Sequence      

MGNQPSSLQTCLRDVCAGQSGCVGYAAFNNDPLYQLTWVKPYNLDSTAAVSPIAVVRPKT
VEQVAGVVKCAASNGKKVQAKSGGHSYGNYGLGGPNSTDVITIDLVNFQQFRMDNETWKA
TMGAGHQLGDVSKKLHDNGGRAMAHGVCPGVGIGGHATIGGLGAMSRQWGSCLDHVLEVE
VVTADGKIQRASEEQNSDLFFALKGAGGSFGVITEFVMKTHPEFGKAVQYMYSFTFQSMR
EQWRVFKAWQDLIGDPDLDRRFGSQIIITPLGCIIEGTFYGSQDEFDATGIVGKLPSTRN
STVQVTDWMGTVVSNAEREALFVSNLASPFYSKSLGFRQQDLLSEDAIKDMFNYIADTRT
GTPIWAIIFDLEGGAINDVPMNATAYAHRDKTMFYQSYAVGIPQVSSTTRSFLSGFHDRV
AASIKDRDAAGAVVYAGYVDPALGDAAQKSYWGSNYPALQRIKAKYDPDDVFRNYQSVRP
DANAKSEEDENGSGSSPTQSGASGPQTTGESNDENLGSVSGPAWALLSLWLMVATMAPLL
L

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	48	254	7.8e-69	0.4344978165938865

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	3.10e-29	52	192	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	2.35e-28	52	481	32	459	FAD/FMN-containing dehydrogenase [Energy production and conversion].
369658	BBE	1.44e-13	434	479	1	45	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
273751	FAD_lactone_ox	1.14e-11	38	243	7	200	sugar 1,4-lactone oxidases. This model represents a family of at least two different sugar 1,4 lactone oxidases, both involved in synthesizing ascorbic acid or a derivative. These include L-gulonolactone oxidase (EC 1.1.3.8) from rat and D-arabinono-1,4-lactone oxidase (EC 1.1.3.37) from Saccharomyces cerevisiae. Members are proposed to have the cofactor FAD covalently bound at a site specified by Prosite motif PS00862; OX2_COVAL_FAD; 1.
215242	PLN02441	5.79e-11	50	214	63	232	cytokinin dehydrogenase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUC19098.1|AA7	4.12e-176	1	480	1	470
UNI23960.1|AA7	1.26e-175	1	480	1	471
CCA70426.1|AA7	2.15e-157	2	480	49	517
AHG26149.1|AA7	1.41e-156	7	505	5	489
QRD00400.1|AA7	4.64e-155	1	480	1	474

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Y0R_AAA	2.60e-58	20	482	28	492	Chain AAA, Chitooligosaccharide oxidase [Fusarium graminearum PH-1]
6YJO_A	2.86e-58	3	482	30	505	Chain A, FAD-binding PCMH-type domain-containing protein [Fusarium graminearum PH-1]
1ZR6_A	8.98e-57	52	480	43	478	The crystal structure of an Acremonium strictum glucooligosaccharide oxidase reveals a novel flavinylation [Sarocladium strictum],2AXR_A Crystal structure of glucooligosaccharide oxidase from Acremonium strictum: a novel flavinylation of 6-S-cysteinyl, 8alpha-N1-histidyl FAD [Sarocladium strictum]
3RJ8_A	1.77e-56	39	480	26	471	Crystal structure of carbohydrate oxidase from Microdochium nivale [Microdochium nivale],3RJA_A Crystal structure of carbohydrate oxidase from Microdochium nivale in complex with substrate analogue [Microdochium nivale]
5K8E_A	1.11e-55	51	480	60	494	Xylooligosaccharide oxidase from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],5L6F_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylobiose [Thermothelomyces thermophilus ATCC 42464],5L6G_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylose [Thermothelomyces thermophilus ATCC 42464]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B6HNK6|SORD_PENRW	3.61e-99	6	480	5	469	FAD-linked oxidoreductase sorD OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=sorD PE=3 SV=1
sp|I1S2K2|CHITO_GIBZE	1.34e-57	20	482	28	492	Chitooligosaccharide oxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=chitO PE=1 SV=1
sp|Q6PW77|GOOX_SARSR	4.25e-56	52	480	62	497	Glucooligosaccharide oxidase OS=Sarocladium strictum OX=5046 GN=gluO PE=1 SV=1
sp|I1SB12|MNCO_MICNN	1.46e-55	39	480	48	493	Carbohydrate oxidase OS=Microdochium nivale OX=5520 GN=MnCO PE=1 SV=2
sp|G2QG48|XYLO_MYCTT	5.71e-55	51	480	60	494	Xylooligosaccharide oxidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=xylO PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000043	0.000000

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00133671-p1.