CAZyme Information: mRNA_M_BR32_EuGene_00132941-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00132941-p1
• CAZy Family: GT2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
604		65824.06	6.6367

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00027:42341-44510(+)

Full Sequence      

MSCVSPKFHESGPVTPTHDQTQSSQAQTVGLRPDKNHNTRAMDLRADACKAGNHGPAYGV
GKDQDQKPSMRAARKSASSSSRSPKMAAAQAVLLLAGHVVAQCPDYVKYSTQRHEPFSTG
RYGMSYMRPPPECRTFRAAEVEDVVDRMKKTIADPDLARLFENAFPNTLDTAIKWHGVAA
DDPSEELTFVITGDIDAMWLRDSANQLQSYMPVLKANSSKESIAGLFRGVINLQARYLLT
SPYCNSFQAPVESKIPPAVNNAAKEDTVKPQYSNSSVFECKYELDSLAAFLQISVDYYNK
TQDADFFGKHKWSDAVRATLKVARDMQTPTYGPDWQVLASPYMFTRVTPRATETLTNDGA
GSPVGNGTGLIRSAFRPSDDSTLFQLFIPANMMFAANLGAAAEIAAKIGGGALADEMRTF
SKQLRDAITAHGIVPDTTNGGIGVGRGNIYAFEVDGFGSAAVMDDANIPSLLSAPLSGYV
SRDDPVYRNTRAVVLNERGVNDNPYFMRGPVINAIGGPHAGPGKAWPMASIVRILTSDDD
DEITRVLKEVVSSTDGLGLIHESINAHNQSDWTRQWFSWANGLFGQMIIDLEGRKPDILK
KSFQ

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00132941-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	154	589	5.2e-162	0.9975124378109452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	154	589	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	9.10e-145	133	602	2	433	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ57723.1|GH125	0.0	42	604	1	563
QRC91719.1|GH125	5.07e-243	99	604	17	513
CBX94219.1|GH125	1.67e-235	101	604	63	557
AQA29358.1|GH125	8.97e-223	88	604	10	516
UJO14502.1|GH125	8.97e-223	88	604	10	516

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2P0V_A	1.07e-85	128	599	43	477	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3P2C_A	6.00e-84	128	599	21	459	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
3ON6_A	3.10e-83	128	599	23	457	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
6RQK_A	1.47e-66	140	590	7	421	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]
5M7I_A	7.82e-66	140	590	7	421	Crystal structure of GH125 1,6-alpha-mannosidase mutant from Clostridium perfringens in complex with 1,6-alpha-mannobiose [Clostridium perfringens str. 13],5M7Y_A Crystal structure of GH125 1,6-alpha-mannosidase mutant from Clostridium perfringens in complex with 1,6-alpha-mannotriose [Clostridium perfringens str. 13]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	1.17e-140	103	602	27	507	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000002

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00132941-p1.