CAZyme Information: mRNA_M_BR32_EuGene_00132241-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00132241-p1
• CAZy Family: GT2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
259		28185.22	9.9414

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00026:249537-250419(-)

Full Sequence      

MVSTRHIAGLLLAAVVARALPGEISQDGSARGGPMAADAPITPPTSCAAGVQIFVVRGST
EPSHMGRIAPVATSIRDAVPGSFITALDYPAKINAAEYFFSVHRGVSRLAKLVRDYVKMC
PQGKIALVGYSQGAHVVGDLVCGASSLPLYRSKPLDPVYNKNIIASLQFGDPSRRANQTW
NVGTVTDRNGYFPRQRNKPCGPYSEAMRSWCDEKDRWCDKKSPTGTDREVHKKYQIKYKD
AAAEFVKKQWESSQKPLGS

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00132241-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	49	249	4e-44	0.9788359788359788

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	5.79e-27	47	249	1	172	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ55171.1|CE5	4.69e-186	1	259	1	259
QBZ65259.1|CE5	2.28e-80	1	257	1	239
VBB73737.1|CE5	3.81e-43	46	253	26	226
CAP67123.1|CE5	3.81e-43	46	253	26	226
CDP24539.1|CE5	3.81e-43	46	253	26	226

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1BS9_A	3.06e-20	46	247	1	203	Acetylxylan Esterase From P. Purpurogenum Refined At 1.10 Angstroms [Talaromyces purpureogenus]
1G66_A	5.94e-20	51	247	5	203	ACETYLXYLAN ESTERASE AT 0.90 ANGSTROM RESOLUTION [Talaromyces purpureogenus]
2AXE_A	8.28e-20	46	247	1	203	Iodinated Complex Of Acetyl Xylan Esterase At 1.80 Angstroms [Talaromyces purpureogenus]
1QOZ_A	3.13e-18	51	249	5	205	Chain A, ACETYL XYLAN ESTERASE [Trichoderma reesei],1QOZ_B Chain B, ACETYL XYLAN ESTERASE [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O59893|AXE2_TALPU	2.69e-19	46	247	28	230	Acetylxylan esterase 2 OS=Talaromyces purpureogenus OX=1266744 GN=axe-2 PE=1 SV=1
sp|A0A2J8C362|CUTI1_VERDA	2.64e-18	51	256	28	235	Cutinase 11 OS=Verticillium dahliae OX=27337 GN=VD0003_g7577 PE=1 SV=1
sp|Q99034|AXE1_HYPJE	1.98e-17	51	258	36	247	Acetylxylan esterase OS=Hypocrea jecorina OX=51453 GN=axe1 PE=1 SV=1
sp|P0A537|CULP3_MYCBO	3.08e-08	52	202	48	190	Probable carboxylesterase Culp3 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=cut3 PE=3 SV=1
sp|P9WP38|CULP3_MYCTO	3.08e-08	52	202	48	190	Probable carboxylesterase Culp3 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=cut3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000236	0.999750	CS pos: 19-20. Pr: 0.9822

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00132241-p1.