CAZyme Information: mRNA_M_BR32_EuGene_00131731-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00131731-p1
• CAZy Family: GT2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
473		48564.95	4.5160

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00026:145223-146644(+)

Full Sequence      

MRTAQALSVFALLVGSGLATPVPASGAYYDGASSMLQPVSAAADFDDADDTAMPASAAFS
AANTRSAIAAAADEDDANDVRMPVSAASSAANTRTAFAAAADEDDANDADDTAIPVSRAF
SAASTRTAFAAAADEDDTEDTADTADTAMPVSAASVGTQGLRGNSRAAAAADDLAAAATN
SSELPLAAAAGDIAIPQGFKKIVFQDNFAKQKAGALPDQAKWLIDLGTQYPGGAANWGTQ
EIQTYTNNPANLGIKNGALTITPMRNGNAWTSARIETKAGSDVQCPPGGKLRVEASLKLA
ASDPATQLGIWPAFWMLGQGFRTDRNSWPKVAEIDILEVSNGVGTVFHTAHCGVINGGPC
KEKTGLGGSGQFPRGRFVKVAVTIDRSNKAGGFQQEKLEWSVDGKVTHTLTGAEVKDADA
WENLARTPKMILLNVAIGGEFPDGKAKIKTPTAKTVGGEPSAMSVQYVAAFST

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00131731-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	205	470	1.6e-47	0.9869565217391304

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185691	GH16_Strep_laminarinase_like	9.37e-124	199	472	1	259	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
185693	GH16_laminarinase_like	1.69e-43	204	468	1	232	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185683	Glyco_hydrolase_16	5.66e-13	206	471	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185694	GH16_CCF	1.27e-11	202	468	1	326	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.
395585	Glyco_hydro_16	1.10e-05	247	448	1	164	Glycosyl hydrolases family 16.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ55217.1|GH16_3	5.29e-273	1	473	1	476
UQC90783.1|GH16_3	4.93e-128	191	473	83	365
AAX07660.1|GH16_3	2.91e-84	193	473	102	387
QBZ61307.1|GH16_3	2.91e-84	193	473	102	387
UNI19827.1|GH16_3	2.24e-81	193	471	36	319

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7EO3_A	1.03e-63	202	468	12	275	Chain A, 1,3-beta-glucanase [Actinomycetia bacterium]
3DGT_A	9.52e-55	196	468	6	271	The 1.5 A crystal structure of endo-1,3-beta-glucanase from Streptomyces sioyaensis [Streptomyces sioyaensis]
3ATG_A	1.62e-25	202	468	5	235	endo-1,3-beta-glucanase from Cellulosimicrobium cellulans [Cellulosimicrobium cellulans]
2HYK_A	2.20e-24	202	468	9	239	The crystal structure of an endo-beta-1,3-glucanase from alkaliphilic Nocardiopsis sp.strain F96 [Nocardiopsis sp. F96]
2VY0_A	2.73e-20	201	472	14	260	The X-ray structure of endo-beta-1,3-glucanase from Pyrococcus furiosus [Pyrococcus furiosus],2VY0_B The X-ray structure of endo-beta-1,3-glucanase from Pyrococcus furiosus [Pyrococcus furiosus]

Swiss-Prot Hits     

mRNA_M_BR32_EuGene_00131731-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000319	0.999669	CS pos: 19-20. Pr: 0.9778

TMHMM  Annotations     

Start	End
7	29