CAZyme Information: mRNA_M_BR32_EuGene_00131711-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00131711-p1
• CAZy Family: GT2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
243		25243.76	5.9524

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00026:140694-141498(+)

Full Sequence      

MLVAASAVVAGPLPPSELTARQAAAAPVPLRIMSAGASVTFGVGSSTGNSYRKDLLDLLQ
GPNATFTKADEVSFVGAKKNGDFDQNAVEATSGFVIKQIAAAMAKDVPTLKPNLVLVDAG
TNNCNKGGVVADAGAQVDKMLRQVFADSPGVTVVMTNVLVNKVAKQDACRVDENKQFDAV
WQKLKDEGAKLVTVDMRSAAGPTTDDLFDTRHPNDAGYVKMANVFFGGIQEAATKGFLTA
PAA

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00131711-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	30	228	1.3e-49	0.9896907216494846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	4.85e-28	89	229	18	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	1.80e-12	60	218	8	174	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	9.64e-09	36	226	5	185	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
395531	Lipase_GDSL	1.43e-04	32	225	1	224	GDSL-like Lipase/Acylhydrolase.
238866	sialate_O-acetylesterase_like2	1.88e-04	110	224	47	163	sialate_O-acetylesterase_like subfamily of the SGNH-hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ55219.1|CE3	5.76e-167	1	243	8	250
AVF19998.1|CE3	3.51e-85	21	241	8	222
UQC73362.1|CE0	1.42e-84	19	242	6	223
AEO66483.1|CE0	6.66e-47	28	241	41	250
UNI21161.1|CE0	3.84e-45	14	241	28	251

PDB Hits     

mRNA_M_BR32_EuGene_00131711-p1 has no PDB hit.

Swiss-Prot Hits     

mRNA_M_BR32_EuGene_00131711-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.992500	0.007557

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00131711-p1.