CAZyme Information: mRNA_M_BR32_EuGene_00129931-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00129931-p1
• CAZy Family: GT62
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
576		65107.28	6.9175

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00025:47728-49735(-)

Full Sequence      

MDVWTEPPRVTKTRQALNILGCICVFLLHRAAGVYTQYPALVDLLISVFFAEYCRFTNEG
RRIALAKAEDAAREQYLDVAQQESKIGLGPPPAAHLSCDAVAMIVGWREDPTLWRRCLES
YRNADGWAFMVVGIDGDDAEDEEMIDIFREPLGEVSSKVLEEKYAELKKWGQVKIDQEDV
HDIAMSRCMDIARQHVQKIMQQDGSIKHLLVHQRHLHKKGIMFTSLVFSMVIAEMKGLRF
LWTSDSDSFVKHDSVQGTICTMASDPGAGGASSGMAIHNADETLVTKLSASVYWCDQYLT
HALPASVGVNDCQSGPSSAFRISAIRPILVSWYNQKVFGKRMIVNEDRHLTTLLLSQGWR
VIYAGDIMTETENPTTLERWIQQQVRWARAQHIETLLPIKVYAMSHPFLFLSALRRELNL
LTIFTQTFAYLFLDRQLLAFNMLDFCLHISGKALYGVIRSPDESQSLLSAVVWIVPGMIF
YNIPQPAVHAWGLATLTADTWGTSMRSSGELAKRDGLSERWYKSGFLVVWIGTVGALLAK
WGLTRLELLPEQRLLGMAVTGLLCSFFMWRQVINYR

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00129931-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133056	GT2_HAS	1.76e-18	245	390	85	231	Hyaluronan synthases catalyze polymerization of hyaluronan. Hyaluronan synthases (HASs) are bi-functional glycosyltransferases that catalyze polymerization of hyaluronan. HASs transfer both GlcUA and GlcNAc in beta-(1,3) and beta-(1,4) linkages, respectively to the hyaluronan chain using UDP-GlcNAc and UDP-GlcUA as substrates. HA is made as a free glycan, not attached to a protein or lipid. HASs do not need a primer for HA synthesis; they initiate HA biosynthesis de novo with only UDP-GlcNAc, UDP-GlcUA, and Mg2+. Hyaluronan (HA) is a linear heteropolysaccharide composed of (1-3)-linked beta-D-GlcUA-beta-D-GlcNAc disaccharide repeats. It can be found in vertebrates and a few microbes and is typically on the cell surface or in the extracellular space, but is also found inside mammalian cells. Hyaluronan has several physiochemical and biological functions such as space filling, lubrication, and providing a hydrated matrix through which cells can migrate.
224136	BcsA	3.48e-15	245	481	145	365	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133033	Chitin_synth_C	3.38e-07	190	387	32	237	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
133043	CESA_CelA_like	5.22e-07	314	389	161	228	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
404400	Glyco_transf_21	9.30e-06	239	389	33	174	Glycosyl transferase family 21. This is a family of ceramide beta-glucosyltransferases - EC:2.4.1.80.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ60217.1|GT2	0.0	1	576	1	589
UNI13287.1|GT2	1.25e-174	6	541	23	570
UKZ95583.1|GT2	1.06e-167	2	573	12	603
CCT71936.1|GT2	4.20e-167	14	574	28	594
AEO60443.1|GT2	3.23e-166	9	574	3	582

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SP7_A	4.89e-18	103	390	88	346	Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2]
7SP6_A	2.01e-17	103	390	88	346	Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SP8_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SP9_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SPA_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O57424|HYAS2_CHICK	8.11e-25	104	508	89	470	Hyaluronan synthase 2 OS=Gallus gallus OX=9031 GN=HAS2 PE=2 SV=2
sp|Q92819|HYAS2_HUMAN	1.45e-24	104	508	89	470	Hyaluronan synthase 2 OS=Homo sapiens OX=9606 GN=HAS2 PE=1 SV=1
sp|P70312|HYAS2_MOUSE	1.94e-24	104	508	89	470	Hyaluronan synthase 2 OS=Mus musculus OX=10090 GN=Has2 PE=1 SV=4
sp|O35776|HYAS2_RAT	2.59e-24	104	508	89	470	Hyaluronan synthase 2 OS=Rattus norvegicus OX=10116 GN=Has2 PE=2 SV=1
sp|G5AY81|HYAS2_HETGA	1.10e-23	104	508	89	470	Hyaluronan synthase 2 OS=Heterocephalus glaber OX=10181 GN=Has2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.984690	0.015312

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00129931-p1.