CAZyme Information: mRNA_M_BR32_EuGene_00129321-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00129321-p1
• CAZy Family: GT1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
996		111082.69	6.8837

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00024:358180-361396(+)

Full Sequence      

MTVFIASLFLPKTVHFRLPGTPSRSAPPPALDKDRAKGDVPAGGLKSPSHAKQPSLFKDI
TPPETPIEERPAAEDIFANEDGLAVPQFPAPTDAGKQRGPADRGSPTWGARRDQPMSRAN
SPPPSSLLNHNKTLALKARELGRMGVKQPLSLTRSDSHDRVFAQADYTIVNADQGNGGLR
NAAEAAAREGKLGDHTYVGTLGMPTDALDGTQQKQDIEDRLATEHDCLAVWCSDKDFDGH
YSHFCKQILWPVFHYQIPDNPKSKAYEDHSWKYYVNVNQAVADKIVKNWKRGDVIWVHDY
HLLLVPGMIRKKLPDAKIGFFLHVAFPSSEVFRCLAVRRELLEGMLGANLVGFQIHEYTR
HFLQTCSRILSAEATPDGLQLEDRFVDVINMPIGIDPVALSEHRKEPQVLEWVNKLRKQY
EGKHLIVARDKLDHVRGVRQKLLSYELFLNQNPEWRGKTMLIQVALSTSEKSELDATVSD
IVTRVNSSWASLTYQPVTYLKQDIGYAQYLALLTIADALMITSQREGMNLTSHEFLACQD
GKNSNDKKHGSLILSEFTGTSSLFGGNELSVNPWDYRACADAIKKALEMSAEEKERRWTK
LYQAVSHHTGAHWFTEFMLRLDRVHEEQHRRDQTSVPRLSVASLSAQYKRSSKRLFILDY
EGTLVSWGPVNQIIPVSPQVQNATSTNPLSAGQQGQPEGRQHIVHPRLGPLTLASPPTIV
THQPPTTIRDVESNVLSPIRPSSPYTTLNKTMRPGDPIQYTDTNPQRTLDVLSDLLLDEQ
NTIYVMSGRRPEELDRLFRARIPNLGLIAENGCLLRKCGADSWTEMADAGHIKNWKESVR
GIMTYFLERTPGAEVEERRCSLVFHYKNAEDYEAAARQASDCASHINDACESQRVHAVAL
DGCVVVEPVDWTKGTAAEKIFDDLRSGDLSPDFLMVVGDGREDEKVFKWANQLGEEGTVK
DVVTVSLGSRNTEARATLTQGVSGVLTALQKLAALS

Enzyme Prediction     

EC	2.4.1.15:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	166	622	3.6e-159	0.9305263157894736

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340820	GT20_TPS	0.0	149	621	10	462	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	0.0	194	623	45	470	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
184712	PRK14501	7.20e-167	193	994	41	725	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
223457	OtsA	3.38e-163	209	626	69	482	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].
215555	PLN03063	7.42e-128	201	947	56	717	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ64164.1|GT20	0.0	1	996	1	996
AEO53735.1|GT20	0.0	1	996	1	905
UQC86110.1|GT20	0.0	1	993	1	901
CAP60259.1|GT20	0.0	9	996	22	919
CDP22899.1|GT20	0.0	9	996	12	909

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JBI_A	2.11e-106	149	624	10	465	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HVM_A	1.56e-100	217	624	73	477	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HUT_A	1.98e-100	149	632	14	478	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
5HUV_A	2.77e-100	149	632	14	478	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]
5HVO_A	4.37e-96	149	621	21	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UUI7|TPSY_SCHPO	1.08e-182	4	994	5	891	Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 100 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC22F8.05 PE=1 SV=1
sp|O14081|TPSX_SCHPO	5.05e-182	3	992	4	941	Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 106 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC2E11.16c PE=1 SV=1
sp|P38426|TPS3_YEAST	1.32e-146	161	994	308	1053	Trehalose synthase complex regulatory subunit TPS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS3 PE=1 SV=3
sp|P38427|TSL1_YEAST	8.10e-143	157	921	336	987	Trehalose synthase complex regulatory subunit TSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TSL1 PE=1 SV=1
sp|Q54K57|TPSA_DICDI	2.37e-118	186	870	48	628	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999755	0.000296

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00129321-p1.