CAZyme Information: mRNA_M_BR32_EuGene_00129161-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00129161-p1
• CAZy Family: GT1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
487		52780.43	5.9107

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00024:324649-326112(-)

Full Sequence      

METKQPPPKPKILYAVPPREGHMRPALQISAQLIEHGYNVTMLGTDRWRDAIEAIGAIYS
PCIGLWAVALDDVSWWPTIVSAPTSAARNAASLDEGFTTLLPSGFQSVCTALTGIMGRDW
ATERIVVLSDTCFSGTLPLKLKTHLPPGCGLEKVKIKTIGIGVVPVYWAAAERPPWGSGL
PYDDSEEGKTRTLQAHQEAWNQEAEDRARKCLTMMACAEKVDTLLEPFNDPASGLRHPFW
DASTVCHDVTLQMGLRGLEFPTPSWPAHLKFAGPLPPKALPSGLKYPAWWDEVVFKNSAA
YSIGHEGGRKKVVFVAQGTEVLDHNELIVPTVQALAGRDDVVVIVVLCVKGATLDASSFA
NGELPANCHVLDYFPYDAILPHADVFLSSSGYGGLTHAVAHAVPLVQTGRFFDKPDIGRR
VEWSGMGVYLADPTGAAPPSAVEVGEAVKKVLGDAKFRRRAGELRDDALRLDPLAAVERE
VAGLSWE

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00129161-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	217	482	6.3e-26	0.5418848167539267

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	6.57e-20	10	478	1	399	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	5.70e-17	9	481	1	395	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
273616	MGT	9.54e-17	18	467	4	372	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ64151.1|GT1	0.0	1	487	1	487
UQC90098.1|GT1	1.99e-186	9	485	106	570
UPK94024.1|GT1	1.68e-74	9	481	25	458
QLI65814.1|GT1	1.38e-70	9	484	7	452
CEI63000.1|GT1	9.71e-67	9	484	21	457

PDB Hits     

mRNA_M_BR32_EuGene_00129161-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|J4VV61|GT1_BEAB2	2.02e-57	11	486	20	457	UDP-glucosyltransferase 1 OS=Beauveria bassiana (strain ARSEF 2860) OX=655819 GN=BBA_08686 PE=2 SV=1
sp|E9L011|UGTB1_STABO	9.71e-46	9	485	5	431	UDP-glucosyltransferase B1 OS=Starmerella bombicola OX=75736 GN=ugtB1 PE=1 SV=1
sp|E7CQW6|UGTA1_STABO	3.93e-39	9	481	7	431	UDP-glucosyltransferase A1 OS=Starmerella bombicola OX=75736 GN=ugtA1 PE=1 SV=1
sp|Q8KHE4|REBG_LENAE	4.30e-36	11	484	4	420	4'-demethylrebeccamycin synthase OS=Lentzea aerocolonigenes OX=68170 GN=rebG PE=1 SV=1
sp|P95747|TYLM2_STRFR	2.57e-07	308	469	269	422	Tylactone mycaminosyltransferase OS=Streptomyces fradiae OX=1906 GN=tylMII PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000035	0.000031

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00129161-p1.