CAZyme Information: mRNA_M_BR32_EuGene_00125921-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00125921-p1
• CAZy Family: GH95
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
798		84576.05	7.8903

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00022:277098-279774(-)

Full Sequence      

MANFPKMGVRLLAFATGFAALTQAIAGTGCNPMTTKNCPPIPGLNTGYYEVDFTNNPKDA
SKYWTTSAGAQIPRDSRGIALQYLKRFDAPQLVSTWYMWYGRVDVQMQVAKGQGVVTSIV
LMSDTLDEMDWEWSGNNFGHGPSKGRVQTNYFGKGVTGTYDRGTTVDVDNPQGTTHTYTL
IWKPDSIEWRIDGKTVRTFYAKDADTKPGSSHQFPQTPAKLQIGIWAGGDPSNAGGVIEW
AGGVTDTNGGPYVAYVKKITVQNQYSAMAYSWADQSGSHGSVKQLSQDPGNLAPVSPALL
PLRSELPVTQIGRCGPELKTICKGSVFGDCCSQYNTCGSTAEYCGSGCQGAYGKCAKPNI
FANEKLEFEPEPTTSVIKTTSSTSTSTSTSTSTSTSTSTTQSTKTSASTPNAPLRTDLPL
TPNGHCGPKVNTICKGSVFGDCCSEYNYCGNGLDYCGAGCQSAFGRCGDAPVEPKAATTS
SSSQPPRVATSPVSSSSTSTSTTTMMTKPTTASTAAPSNNTPVANVKLAVSEDGSCGGKE
AKFTCTGGIFGECCSQYNFCGNSKDHCSTGCQVGFGRCEGVPVVSAAEPQKPNNAAANPS
TSSPTSSSPAAATTGPQINIGYTCDDDFWWRNNYCYKYMGANGQMKRMTSAFCYQWSGKM
SDVPNWLSKDCEGDIERIRGACCGRWIVPQDAVPSPPSAPAATTPIKLARRQDDASGVGR
GKGPSPWARVAEYLARKQAQAAGDEADRRAEEAATRRDAGTDEQGGSTDKAYVRGRRENA
AAATARDVRRIVGRDVLV

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	78	243	5.5e-61	0.9810126582278481

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185692	GH16_fungal_CRH1_transglycosylase	1.06e-98	51	266	1	203	glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
395585	Glyco_hydro_16	1.09e-47	84	242	17	168	Glycosyl hydrolases family 16.
185684	GH16_lichenase	1.94e-18	100	259	68	208	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
185683	Glyco_hydrolase_16	4.93e-18	52	257	2	208	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
225182	BglS	1.52e-15	99	287	117	286	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ64343.1|CBM18|GH16_18	0.0	1	798	1	808
BAI44127.1|CBM18|GH16_18	0.0	1	798	1	793
SMR46394.1|GH16_18	8.29e-71	11	287	6	286
SMY21548.1|GH16_18	8.29e-71	11	287	6	286
SMR47644.1|GH16_18	8.29e-71	11	287	6	286

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IBU_A	4.83e-68	30	283	4	243	Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBU_B Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBW_A Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293],6IBW_B Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293]
3O5S_A	1.12e-13	40	248	33	224	Crystal Structure of the endo-beta-1,3-1,4 glucanase from Bacillus subtilis (strain 168) [Bacillus subtilis]
1GBG_A	1.80e-13	40	242	9	194	Bacillus Licheniformis Beta-Glucanase [Bacillus licheniformis]
3D6E_A	6.42e-13	100	242	59	181	Crystal structure of the engineered 1,3-1,4-beta-glucanase protein from Bacillus licheniformis [Bacillus licheniformis],3D6E_B Crystal structure of the engineered 1,3-1,4-beta-glucanase protein from Bacillus licheniformis [Bacillus licheniformis]
1U0A_A	6.84e-12	78	248	50	200	Chain A, Beta-glucanase [Paenibacillus macerans],1U0A_B Chain B, Beta-glucanase [Paenibacillus macerans],1U0A_C Chain C, Beta-glucanase [Paenibacillus macerans],1U0A_D Chain D, Beta-glucanase [Paenibacillus macerans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8J0P4|CRF1_ASPFU	1.12e-65	21	283	16	264	Probable glycosidase crf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=crf1 PE=1 SV=2
sp|D4B4J2|CRH12_ARTBC	1.31e-54	18	283	16	270	Probable extracellular glycosidase ARB_03382 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03382 PE=3 SV=2
sp|P53301|CRH1_YEAST	3.03e-51	30	283	40	276	Probable glycosidase CRH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRH1 PE=1 SV=1
sp|Q5AFA2|CRH11_CANAL	1.67e-50	30	283	24	261	Extracellular glycosidase CRH11 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CRH11 PE=1 SV=1
sp|D4ALQ5|CRH11_ARTBC	4.39e-43	12	301	5	281	Probable extracellular glycosidase ARB_05253 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05253 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000207	0.999765	CS pos: 24-25. Pr: 0.9767

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00125921-p1.