CAZyme Information: mRNA_M_BR32_EuGene_00123881-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00123881-p1
• CAZy Family: GH88
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
459		51973.77	6.1130

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00021:205555-207038(-)

Full Sequence      

MSGPSPVEWDCLLGITRNCSRTGQHDRECLAAKLPVKPRIIARSRSIFPGQMRGWSVEFP
PSGIGGLSVSNICLPAQSLCKFEIMPSELHGIKAADIHAKIRLLIDGMVNIKDTTGEFLL
KLEDGRVIDTKGWNDWEWTHGIGLYGIWQYYQLTGDESCLEIIEDWFRDRFAAGGTTKNI
NTMSVFLTLAFVYEKTRNPIYLPWLEAWAEWAYHDLGRTRFGGMQHTTYNNMNDEQLWDD
TLMMTVVPLAKIGLVLDRPHYVAEAKRQFLIHLKYLFDTRTGLFFHGWTFEDGGHNFARA
LWARGNSWLTIVIPEFIELLDLERTDPPLYHHLRDSLLAQCEALVPLQHPETGLWRTLLD
VPEAEGSYPESSATAGFAFGMLKAQRKKYIAGTAFEAPAVLALKGVLANIDERGELMNTS
FGTAMGHDLQHYKDIPITSMPYGQAMAIMALVEFLRVFI

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00123881-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	131	456	3e-102	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	4.89e-104	108	458	8	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	1.19e-95	110	458	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ65407.1|GH105	2.87e-283	85	459	1	375
UPK91701.1|GH105	2.96e-208	85	459	1	372
CAE76464.1|GH105	1.10e-206	85	459	1	375
UQC83867.1|GH105	1.56e-206	87	459	6	375
QLI63582.1|GH105	8.34e-206	85	459	1	373

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XUV_A	3.48e-201	94	459	5	373	Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3QWT_A	6.68e-145	90	456	19	378	Chain A, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	4.22e-141	92	456	22	379	Chain A, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O31521|URHG1_BACSU	4.45e-40	136	456	29	337	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	9.25e-09	253	416	10	173	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	9.25e-09	253	416	10	173	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
sp|P9WF04|UH105_ALTSL	3.74e-07	238	381	201	340	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000048	0.000001

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00123881-p1.