CAZyme Information: mRNA_M_BR32_EuGene_00121621-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00121621-p1
• CAZy Family: GH76
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
277	BR32_scaffold00020|CGC3	29827.83	7.1462

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00020:226371-227204(+)

Full Sequence      

MVQFSLTSALALASSLFAASTLAAKSNGCGSVNATLTTGVRQINVNGLQRQYTLKLPDGY
DGKTPMKLVFAWHWRFSRMEDVVTGVSIQPWYGLESRAKGSAIFVAPDGINKEWPNDGGR
DVAFADAMIKELESGLCIDTDQLFSTGFSYGASMTFALACARPKVFRAVSIIGGGQVSGC
EGGTDPVNFLQFHGTEDTVFPMDKGLELKDRFVKNNGCQAKDITMPTNPGQSTRTDFTCT
KKKLSFVAYVGGHVGAPLGEQNPLAPDTTWDFFTKST

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00121621-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	48	178	1.1e-16	0.5903083700440529

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226040	LpqC	1.95e-17	6	273	11	304	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
223477	YpfH	2.10e-06	117	225	75	186	Predicted esterase [General function prediction only].
224423	DAP2	6.62e-05	46	174	374	506	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
226584	COG4099	1.14e-04	126	201	254	330	Predicted peptidase [General function prediction only].
223489	DLH	1.80e-04	125	201	96	173	Dienelactone hydrolase [Secondary metabolites biosynthesis, transport and catabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSB17085.1|CBM2|CE0	2.89e-72	28	275	38	287
EGX54170.1|CBM1|CE0	1.18e-71	24	277	92	356
QBZ61744.1|CBM1|CE0	4.97e-71	22	273	19	266
UKZ97189.1|CBM1|CE0	7.23e-71	22	275	44	295
UKZ53227.1|CBM1|CE0	7.27e-71	22	275	20	271

PDB Hits     

mRNA_M_BR32_EuGene_00121621-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CDX2|FAEC_ASPTN	7.05e-100	24	274	22	268	Probable feruloyl esterase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=faeC PE=3 SV=1
sp|A2QYU7|FAEC_ASPNC	9.38e-98	24	273	22	267	Probable feruloyl esterase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=faeC PE=3 SV=1
sp|Q5B2G3|FAEC_EMENI	5.04e-95	24	273	22	267	Feruloyl esterase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=faeC PE=1 SV=1
sp|A1DI08|FAEC_NEOFI	2.18e-89	12	273	11	269	Probable feruloyl esterase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=faeC PE=3 SV=1
sp|B8N7Z6|FAEC_ASPFN	4.11e-89	24	273	22	267	Probable feruloyl esterase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=faeC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000360	0.999612	CS pos: 23-24. Pr: 0.9758

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00121621-p1.