CAZyme Information: mRNA_M_BR32_EuGene_00121401-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00121401-p1
• CAZy Family: GH76
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
462		51689.51	8.5579

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00020:156635-158022(-)

Full Sequence      

MAYHTCSIFKRRPAVFFLLIGIFFLISIHRKQSLFVTETYSQFQAQPDLNDGNFHWANVP
LNHPISPQFMTKIPSTRAKAIPKIQHAFKKETPEQRKVRLARLEQVRSNFTHAWSGYKKF
AWLHDEVLPVTGGERDVFGGWAATLVDSLDSLYIMGLTDDFDEAVQAVIKIDFTKTSLDE
INVFETTIRYLGGLLAAYDISGGRRGNHATVLLHKAIELGDMLYVAFDTPNHMPILRWKL
KALMDAVKAPYGGLNGQTQGVAADGQKRLMSPPNQAAPDGGLIAEIGSLTLEFTRLSQIT
GNPKYFDAVQRIMDLLAKQQDDTRLPGMWPVVIGPSRANFREHTGFSIGGMADSVYEYLP
KEYILLSGKLPQYQEMYTKALGAMKRNIFYRPRITSPYGKEAPRILLPGDIQVEPNEPLL
GQEPEPRVQHLGCFAGGMVALAARAFSTPQEMDTARQLVEGC

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00121401-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	110	462	6.9e-105	0.6883408071748879

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	8.39e-138	110	462	2	312	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	2.14e-77	37	462	22	386	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ58187.1|GH47	0.0	1	462	1	462
CAY05992.1|GH47	0.0	1	462	1	462
CAY09752.1|GH47	0.0	1	462	1	462
CAY09784.1|GH47|3.2.1.113	1.60e-142	10	462	7	443
AAG48158.1|GH47|3.2.1.113	1.60e-142	10	462	7	443

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2RI8_A	4.47e-41	101	462	4	326	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]
1KKT_A	7.80e-41	101	462	39	361	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]
1X9D_A	4.07e-40	65	462	52	395	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]
5KKB_A	1.41e-39	105	443	25	313	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]
5KIJ_A	1.48e-39	110	462	13	312	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8H116|MNS2_ARATH	2.22e-43	102	451	98	395	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS2 OS=Arabidopsis thaliana OX=3702 GN=MNS2 PE=1 SV=1
sp|Q9C512|MNS1_ARATH	6.04e-41	90	451	86	395	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS1 OS=Arabidopsis thaliana OX=3702 GN=MNS1 PE=1 SV=1
sp|P31723|MAN12_PENCI	4.01e-40	101	462	39	361	Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Penicillium citrinum OX=5077 GN=MSDC PE=1 SV=2
sp|Q4WRZ5|MNS1B_ASPFU	8.05e-40	101	462	31	353	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mns1B PE=3 SV=1
sp|B0XMT4|MNS1B_ASPFC	8.05e-40	101	462	31	353	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mns1B PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998779	0.001258

TMHMM  Annotations     

Start	End
13	30