CAZyme Information: mRNA_M_BR32_EuGene_00116831-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00116831-p1
• CAZy Family: GH64
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
309	BR32_scaffold00018|CGC4	33871.22	5.2040

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00018:294456-295517(-)

Full Sequence      

MHLSSGITLAVAVSAQAISIPLAPRDSQPQSRASMWKPAVGTTWQIVLKHPLTINPQSPA
VEPSHVDVYDIDLFDNTKNGTDGSTIAALHSLGKKVICYFSAGTYEGWRPDAGDFKAADK
GNRMNNWNETWVNINSPDIRDVMAKRIKIAADVGCDAIDPDNVDGYLEAPVNDQGPSTSR
LDKASTASFVKFLSAEAAKYKMSTGLKNAAEVIDDVISDVHFSVNEECAAWKECNMFLKF
IEAGKPVFHIEYPAGMEKDADETPLKDLGKWCRKSPDWSGPDVDISKMNLQLNGWVQYCD
GKTFKTPRG

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00116831-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH114	44	252	1.3e-67	0.9947368421052631

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397552	Glyco_hydro_114	9.41e-89	43	260	1	199	Glycoside-hydrolase family GH114. This family is recognized as a glycosyl-hydrolase family, number 114. It is endo-alpha-1,4-polygalactosaminidase, a rare enzyme. It is proposed to be TIM-barrel, the most common structure amongst the catalytic domains of glycosyl-hydrolases.
226386	COG3868	1.09e-22	43	270	62	282	Predicted glycosyl hydrolase, GH114 family [Carbohydrate transport and metabolism].
225219	COG2342	1.83e-04	69	252	44	251	Endo alpha-1,4 polygalactosaminidase, GH114 family (was erroneously annotated as Cys-tRNA synthetase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ54976.1|GH114	2.31e-230	1	309	4	312
QPC57814.1|GH114	1.30e-84	31	304	70	328
QKD54655.1|GH114	5.68e-84	30	306	77	340
CEI66770.1|GH114	6.45e-83	30	307	77	341
QPC77308.1|GH114	6.45e-83	30	307	77	341

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6OJ1_A	2.70e-66	36	299	34	277	Crystal Structure of Aspergillus fumigatus Ega3 [Aspergillus fumigatus Af293]
6OJB_A	4.50e-66	36	299	51	294	Crystal Structure of Aspergillus fumigatus Ega3 complex with galactosamine [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

mRNA_M_BR32_EuGene_00116831-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000382	0.999614	CS pos: 25-26. Pr: 0.7878

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00116831-p1.