CAZyme Information: mRNA_M_BR32_EuGene_00115791-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00115791-p1
• CAZy Family: GH62
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
436		47135.79	6.0490

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00018:53876-55262(+)

Full Sequence      

MRPTTLVLPLAVLAGSVTARLTRPEGRGLQSREAPQDITPNRDSGAYRSVAYVTNWSIYG
AKFLPEQIAVDSISHVQYAFADILANGTVVSSDAWADTQKQFGNGTQGGNSSDAHGLVEQ
LYKIKQANRNVKMLLSIGGYTWSPKFVPVAADAGKRAAFVSSAVALMGDWGMDGLDVDWE
YPDTAETNKNCVLLLQELRRGLDDYSQQHTGGQYKFSLSMPAPAGPTHYAAFDFKAMDAS
LDFWSIMAFDFAGSWDNTTGHQANVYPGPDLTTKASIDVAVSDYVKAGVAAGKINLGLPL
YGRSFDKTTGLGKGYTASTAGSLEGQAGIWIYKDLPRAGATVLYDDVAKASYTMDNSTGQ
LISYDDLKSVQFKSDYVKQKQIGGVMFWESSQDRPGSDSIVRTMARSLGKLESAQNWLSY
PGSQYANIKNNMGQAV

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00115791-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	47	400	6.1e-72	0.9594594594594594

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119365	GH18_chitinase	8.35e-126	49	393	1	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
214753	Glyco_18	2.29e-111	48	393	1	334	Glyco_18 domain.
225862	ChiA	3.33e-83	46	409	37	437	Chitinase, GH18 family [Carbohydrate transport and metabolism].
119351	GH18_chitolectin_chitotriosidase	5.70e-82	50	388	2	336	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
395573	Glyco_hydro_18	7.22e-82	48	393	1	307	Glycosyl hydrolases family 18.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ55077.1|GH18	0.0	1	436	1	436
UQC75004.1|GH18	1.05e-162	6	432	2	422
ASV51323.1|GH18	1.99e-147	44	436	220	611
EAA36073.3|GH18	8.29e-135	5	429	7	420
AEO70479.1|GH18	7.65e-133	47	432	102	487

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EPB_A	1.95e-117	44	432	35	422	Structure of Chitinase 42 from Trichoderma harzianum [Trichoderma harzianum]
6YLJ_A	2.52e-115	44	432	35	422	Chain A, Endochitinase 42 [Trichoderma harzianum],6YN4_A Chain A, Endochitinase 42 [Trichoderma harzianum],7AKQ_A Chain A, Endochitinase 42 [Trichoderma harzianum]
1D2K_A	1.06e-114	45	432	1	390	Chain A, CHITINASE 1 [Coccidioides immitis],1LL4_A Chain A, Chitinase 1 [Coccidioides immitis],1LL4_B Chain B, Chitinase 1 [Coccidioides immitis],1LL4_C Chain C, Chitinase 1 [Coccidioides immitis],1LL4_D Chain D, Chitinase 1 [Coccidioides immitis]
6IGY_A	2.67e-114	35	429	4	400	Crystal structure of Aspergillus niger chitinase B [Aspergillus niger]
1LL7_A	2.99e-114	45	432	1	390	Chain A, CHITINASE 1 [Coccidioides immitis],1LL7_B Chain B, CHITINASE 1 [Coccidioides immitis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|E9ERT9|CHI1_METRA	1.48e-124	11	432	3	423	Endochitinase 1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=chit1 PE=3 SV=1
sp|P32470|CHI1_APHAL	4.25e-121	42	432	34	422	Chitinase 1 OS=Aphanocladium album OX=12942 GN=CHI1 PE=1 SV=2
sp|P48827|CHI42_TRIHA	5.70e-116	44	432	35	422	Endochitinase 42 OS=Trichoderma harzianum OX=5544 GN=chit42 PE=1 SV=1
sp|O14456|CHI1_METAN	6.48e-115	11	432	3	422	Endochitinase 1 OS=Metarhizium anisopliae OX=5530 GN=chit1 PE=1 SV=1
sp|A6N6J0|CHI46_TRIHA	1.15e-114	34	432	26	429	Endochitinase 46 OS=Trichoderma harzianum OX=5544 GN=chit46 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.002393	0.997593	CS pos: 19-20. Pr: 0.9690

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00115791-p1.