CAZyme Information: mRNA_M_BR32_EuGene_00114531-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00114531-p1
• CAZy Family: GH55
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357	BR32_scaffold00017|CGC3	37164.42	7.4589

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00017:407035-408380(+)

Full Sequence      

MKTSTLLSVTLLGLIPGALGQAAHWGQCGGQGWSGPTTCASGSCCVASNQWYSQCIPGGS
CGGGGTNPPTNPPTNPPTNPPTNPPTNPPSTGDQSAGCGKAPITSGTKSINVNGRNRQYI
LRVPNNYDSNKPYRLIFGFHWLGGNMDDVATGRTVQAGTWDYYGLRRLADENAIFVAPNG
LNAGWGNAGGEDVAFVDALVRSLEDDLCVNPRLRFATGFSFGGAMSYALACSRSSVFRAV
SVIAGGPMSGCEGGTAPVPYLGIHGLRDNVLPIATGRQLRDRFVANNGCTPQNPPEPAQG
SLRHVKTVYGGCRDGFPLTWIAYDGGHVAAPADGTAGDNGSTTFAPAETWAFFQQFS

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00114531-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	113	249	4.5e-22	0.5991189427312775

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226040	LpqC	2.28e-23	109	355	39	306	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
197593	fCBD	2.28e-13	23	56	1	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
395595	CBM_1	2.89e-13	24	52	1	29	Fungal cellulose binding domain.
224423	DAP2	1.30e-06	113	246	374	506	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
223477	YpfH	1.83e-05	130	283	15	172	Predicted esterase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ61811.1|CBM1|CE0|GH27	2.88e-239	2	357	610	969
EGX54170.1|CBM1|CE0	2.04e-152	1	357	1	356
UFR06221.1|CBM2|CE1	6.61e-127	95	356	48	310
QKV79912.1|CBM2|CE0	1.56e-126	95	356	33	295
AWT41099.1|CBM2|CE0	1.24e-125	95	356	49	311

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X39_A	7.09e-10	22	56	2	36	Chain A, Exoglucanase 1 [Trichoderma reesei]
6Q8M_A	1.38e-09	22	56	372	406	GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8M_B GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8N_A GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872],6Q8N_B GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872]
1CBH_A	2.49e-09	23	56	3	36	Chain A, C-TERMINAL DOMAIN OF CELLOBIOHYDROLASE I [Trichoderma reesei],2CBH_A Chain A, C-TERMINAL DOMAIN OF CELLOBIOHYDROLASE I [Trichoderma reesei],2MWJ_A Chain A, Exoglucanase 1 [Trichoderma reesei],2MWK_A Chain A, Exoglucanase 1 [Trichoderma reesei],5X34_A Chain A, Exoglucanase 1 [Trichoderma reesei],5X35_A Chain A, Exoglucanase 1 [Trichoderma reesei],5X36_A Chain A, Exoglucanase 1 [Trichoderma reesei],5X37_A Chain A, Exoglucanase 1 [Trichoderma reesei],5X38_A Chain A, Exoglucanase 1 [Trichoderma reesei]
4BMF_A	4.84e-09	24	56	6	38	Chain A, ENDOGLUCANASE EG-1 [Trichoderma reesei]
1AZ6_A	1.19e-08	23	56	3	36	Chain A, CELLOBIOHYDROLASE I [Trichoderma reesei],1AZH_A Chain A, CELLOBIOHYDROLASE I [Trichoderma reesei],5X3C_A Chain A, Exoglucanase 1 [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CDX2|FAEC_ASPTN	1.46e-89	94	353	23	267	Probable feruloyl esterase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=faeC PE=3 SV=1
sp|Q5B2G3|FAEC_EMENI	2.93e-89	92	353	21	267	Feruloyl esterase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=faeC PE=1 SV=1
sp|A2QYU7|FAEC_ASPNC	3.34e-88	92	353	21	267	Probable feruloyl esterase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=faeC PE=3 SV=1
sp|B0XU32|FAEC_ASPFC	2.03e-87	94	353	25	269	Probable feruloyl esterase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=faeC PE=3 SV=1
sp|A4D9B6|FAEC_ASPFU	2.03e-87	94	353	25	269	Probable feruloyl esterase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=faeC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000225	0.999740	CS pos: 20-21. Pr: 0.9807

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00114531-p1.