CAZyme Information: mRNA_M_BR32_EuGene_00113401-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00113401-p1
• CAZy Family: GH5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
706		72290.37	7.2037

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00017:108836-111465(+)

Full Sequence      

MRTFFAATFVLLALTGSGLGLSVSNDATCGGNTGNTCLGSVFGNCCSQYGYCGSTTDHCS
GGCQAGFGSCSSGGGGGGSQPAPVLKASSDGTCGGSTGSTCAGTPFGTCCSQYGYCGSTD
AHCTGGCQSGFGSCSSGGGGSQPPPPALNTSPDGTCGGNTGSTCAGSGFGNCCSSSGWCG
NGDAYCGQGCQAGFGNCGSSQPSGTATGSQPSGTATGQPSGTSIPTGQLAACLSAANVPA
IFPGSSDYNTLAKPYNVRLPFKPAVIVLATTVQHVQNAVKCASNAMIKVQARSGGHSYAA
FGLGGQDGSMMVDLQGMQSISIDSKNVAKVGGGVRLGNLANTLYNQGKRAVSHGTCPGVG
IGGHFTHGGFGYSSRAWGLALDHITQLEVVTADGKVVMASATQNTDLFYAMRGAGESFGI
VTTFYLRTEAAPTAVVNWSFGFANQFDTPSVGAKTMLRIQSFARNASVIDRKIGMGVYLD
GETFSFSGTYFGSLSDFNTKIKPELLRGMPTPASQSIKSVGWIESLTMLAGKSTIVESTQ
TGSYDEHDNFLAKSLVVPESSPITSEAMNSYFQTIKDKSAAAGSSWFSIFNLYGGPDSQI
NSVSAASSSYSDRTSLWVIQNYGFTSLDTSPFPLNTVQTYLSALNSALQLRSTAGFGAYL
NYVDPTLSATQAHDLYYGKTTYAKLQSIKRVMDPNQLFWNPQAITV

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00113401-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	254	441	2.1e-78	0.4104803493449782

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	2.02e-22	263	397	1	136	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	6.78e-19	260	489	29	268	FAD/FMN-containing dehydrogenase [Energy production and conversion].
211316	ChtBD1_1	8.19e-17	155	198	1	44	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
211316	ChtBD1_1	6.87e-13	28	64	1	37	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
211316	ChtBD1_1	7.65e-13	92	128	1	37	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ61916.1|AA7|CBM18	0.0	1	706	1	718
BAI44126.1|AA7|CBM18	0.0	1	706	1	718
CBX96933.1|AA7|CBM18	5.97e-184	80	706	20	644
CAE7194773.1|AA7|CBM18	9.23e-163	151	704	31	564
CCD53507.1|AA7|CBM18	4.47e-145	232	704	46	518

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5K8E_A	6.31e-89	220	704	15	492	Xylooligosaccharide oxidase from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],5L6F_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylobiose [Thermothelomyces thermophilus ATCC 42464],5L6G_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylose [Thermothelomyces thermophilus ATCC 42464]
3RJ8_A	1.85e-87	227	704	1	469	Crystal structure of carbohydrate oxidase from Microdochium nivale [Microdochium nivale],3RJA_A Crystal structure of carbohydrate oxidase from Microdochium nivale in complex with substrate analogue [Microdochium nivale]
6Y0R_AAA	5.69e-82	222	704	18	488	Chain AAA, Chitooligosaccharide oxidase [Fusarium graminearum PH-1]
6YJO_A	1.09e-78	229	704	35	501	Chain A, FAD-binding PCMH-type domain-containing protein [Fusarium graminearum PH-1]
1ZR6_A	3.88e-72	231	700	11	472	The crystal structure of an Acremonium strictum glucooligosaccharide oxidase reveals a novel flavinylation [Sarocladium strictum],2AXR_A Crystal structure of glucooligosaccharide oxidase from Acremonium strictum: a novel flavinylation of 6-S-cysteinyl, 8alpha-N1-histidyl FAD [Sarocladium strictum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2QG48|XYLO_MYCTT	3.25e-88	220	704	15	492	Xylooligosaccharide oxidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=xylO PE=1 SV=1
sp|I1SB12|MNCO_MICNN	1.76e-86	227	704	23	491	Carbohydrate oxidase OS=Microdochium nivale OX=5520 GN=MnCO PE=1 SV=2
sp|I1S2K2|CHITO_GIBZE	2.93e-81	222	704	18	488	Chitooligosaccharide oxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=chitO PE=1 SV=1
sp|Q6PW77|GOOX_SARSR	1.81e-71	231	700	30	491	Glucooligosaccharide oxidase OS=Sarocladium strictum OX=5046 GN=gluO PE=1 SV=1
sp|P9WEY2|DPMAF_METAN	1.26e-65	230	704	30	489	FAD-linked oxidoreductase dpmaF OS=Metarhizium anisopliae OX=5530 GN=dpmaF PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000213	0.999770	CS pos: 20-21. Pr: 0.9805

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00113401-p1.