CAZyme Information: mRNA_M_BR32_EuGene_00112441-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00112441-p1
• CAZy Family: GH5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
633	BR32_scaffold00016|CGC2	69266.44	6.0866

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00016:675023-676924(-)

Full Sequence      

MRLPQLTFWLAAIAASVDAQSPAPPVFTDTGDSALAFDLSQVTLNQGRFRDNQDRTLTYI
KFVDLNRLLYNFRANHGVSTNGAQANGGWDAPDFPFRSHIQGHFLTAWANCYAVLKDQEC
RSRAEQFVEELAKCQDNNAAAGFQAGYLSGFPESDITAVEQRTLTNGNVPYYAIHKTMAG
LLDVWRNVGSTKAKDVLVKMAGWVDTRTARLSYAQMQSMMGTEFGGMSEVLADMFHQTGD
ERWLTVARRFDHAAVLDPLARSQDSLDGLHANTQVPKWIGAAREYKATKDQRYLDIARNA
WDFTVEAHTYAIGGNSQSEHFRPPNAIAGYLLHDTAEACNTYNMLKLTRELFMHDAAPAM
NDTAKFDFYERALLNHLLGQQDPGDGHGHVTYFTPLNPGGRRGVGPAWGGGTWSTDYESF
WCCQGTGIETNTKLMDSIYFRSRDNNALYVNLFIPSSVQWSDRDGVVVTQETEFPLGDAT
TLTVSGAGGGRWTLSVRIPSWVAGGAEVSVNGQKVGGDVRTTPGGYAAVTREWAVGDKVT
VRLPMKLHTVAANDDPTLVALAYGPAILSGKYGDQSLNQIPTLDLGSVKSTGKSLEFAAK
DGNGADVTLGPFYDAHGINYNVYWKAKGALPTV

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00112441-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	41	568	9.6e-197	0.9960238568588469

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400342	Glyco_hydro_127	1.51e-173	41	569	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
226063	COG3533	4.52e-105	39	581	9	514	Uncharacterized conserved protein, DUF1680 family [Function unknown].
406713	DUF4986	0.007	567	624	18	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ66341.1|GH146	0.0	1	633	35	667
AEO59579.1|GH146	6.29e-299	37	631	10	607
AYF28204.1|CBM13|GH146	3.94e-298	19	625	37	633
QOV40477.1|CBM13|GH146	2.44e-297	2	630	9	633
QLQ36379.1|CBM13|GH146	5.39e-296	10	626	28	634

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	5.01e-98	30	625	21	649	Chain AAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	1.18e-92	30	625	21	649	Beta-L-arabinofuranosidase [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

mRNA_M_BR32_EuGene_00112441-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000207	0.999755	CS pos: 19-20. Pr: 0.9774

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00112441-p1.