CAZyme Information: mRNA_M_BR32_EuGene_00111971-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00111971-p1
• CAZy Family: GH5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
629	BR32_scaffold00016|CGC1	68055.71	5.4642

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00016:579187-581076(-)

Full Sequence      

MVRYTRLIYLISGFCTARVRAGGIKLSRSLLRSEGYDYVIVGGGTSGLVLANRLSADPTK
TVLVVEYGDFDRSNETSIPLLTTGDQSSRLYQDMTSTPQSGLAGRIFNARIGNTVGGSST
VNGMAWDCGSAADYNAWEALGNPGWGWDGLRPYLRKAAIFTPPGEDFVKRYSYTWTPEAY
GDDGMVNVTLPSWQWPAAVMQAAGWTDDLQEPMRRDGADGNNVGISWLPQNSDVVKGTRS
TSTTAYYDPVSGRDNLDLLVRHYGGRVLFDSDQAVTGVAIHSRDEDDLPSDGPVVVQTKE
VILAAGAINTPRLLQLSGIGHASHLESVGIHVVADLAGVGANFQDHPAVYIIYDFLNDTR
PNPRSMQENATFRNAAWAEYHANRTGPLSHAWGNTVVFQSLQDLVSSPQEVLDSIDRQDS
LAHLPAVYADNTSLLAGFLAQRAVMRQGYANPKYGIYEITFGGDKSVVTALQKPFSRGTI
TITNTTRANPSTPPIIDYSSLSNPVDIQMLVKGVARVREFMAAPSVVEILKPVELIPGPG
TDDPVALEEMLRESMVVPSFDHPVGTAAVAPRHLGGVVDSKTMEVYGVRGLRVVDASIMP
LLPAAHTQWTVYAVAEKAAELILKSAKVH

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00111971-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	35	624	8.5e-163	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.80e-82	36	623	6	532	choline dehydrogenase; Validated
225186	BetA	1.98e-69	36	627	8	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	6.05e-47	37	623	2	487	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	2.46e-30	474	618	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.19e-29	104	348	16	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ66380.1|AA3_2	0.0	1	629	1	629
EAQ70756.1|AA3_2	0.0	1	629	1	605
UPK99906.1|AA3_2	3.24e-222	36	622	41	615
UQC77231.1|AA3_2	4.49e-174	36	622	44	620
ATZ53654.1|AA3_2	1.45e-137	33	622	36	617

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	3.99e-101	36	628	6	588	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6O9N_A	3.06e-95	15	624	11	640	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
5OC1_A	2.70e-67	36	622	2	561	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.44e-66	36	622	3	562	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6XUT_A	1.17e-59	21	622	2	587	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUN2|XPTC_EMENI	4.17e-90	31	622	33	613	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|M5EAX2|GMCH_MALS4	1.12e-65	31	623	42	616	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	1.12e-65	31	623	42	616	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|P0DO29|ERIK_HERER	7.60e-64	31	622	29	595	Dehydrogenase eriK OS=Hericium erinaceus OX=91752 GN=eriK PE=3 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	4.04e-62	29	629	33	636	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.917787	0.082253

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00111971-p1.