CAZyme Information: mRNA_M_BR32_EuGene_00109531-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00109531-p1
• CAZy Family: GH47
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
299		30582.54	4.9687

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00015:835461-836509(-)

Full Sequence      

MVSALPIAGLLVAAVAAQTPDASLAPPTSCAPGVQIFAARGTTEAPGVGKIQTVAGNVTA
AIPGSAVTAVDYPATFDDYAQSVATGSSDLGQLVKDYVKMCPDSKVALLGYSQGAQAVAD
LICGASSELMPVKTADLDSIYDKNIIAMILFGDPTRAANQSFNLGTVTDRDGLFPRLKND
ACEPYSPRLRSWCDVADRYCDPSAPGGIDTTVHGTYFNKYTQAAKDFIVEQWQLSQKSLP
PRSSIGSAQPTGTANGTHPAHPTGAPVPTSTTPVAAGASRTGAAAFGAILMAGVAAFLA

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00109531-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	31	231	6.7e-47	0.9841269841269841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	2.36e-37	30	231	1	172	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ65259.1|CE5	1.72e-208	1	299	1	299
QBZ55171.1|CE5	1.85e-80	1	239	1	257
QUC15857.1|CE5	2.57e-51	30	233	29	230
CAP67123.1|CE5	5.96e-51	29	235	26	226
CDP24539.1|CE5	5.96e-51	29	235	26	226

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1BS9_A	8.48e-25	29	228	1	202	Acetylxylan Esterase From P. Purpurogenum Refined At 1.10 Angstroms [Talaromyces purpureogenus]
1G66_A	1.18e-24	32	228	3	202	ACETYLXYLAN ESTERASE AT 0.90 ANGSTROM RESOLUTION [Talaromyces purpureogenus]
1QOZ_A	1.65e-24	32	231	3	205	Chain A, ACETYL XYLAN ESTERASE [Trichoderma reesei],1QOZ_B Chain B, ACETYL XYLAN ESTERASE [Trichoderma reesei]
2AXE_A	1.21e-23	29	228	1	202	Iodinated Complex Of Acetyl Xylan Esterase At 1.80 Angstroms [Talaromyces purpureogenus]
4PSC_A	4.96e-08	34	154	82	194	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q99034|AXE1_HYPJE	8.07e-26	32	259	34	264	Acetylxylan esterase OS=Hypocrea jecorina OX=51453 GN=axe1 PE=1 SV=1
sp|O59893|AXE2_TALPU	8.01e-24	29	228	28	229	Acetylxylan esterase 2 OS=Talaromyces purpureogenus OX=1266744 GN=axe-2 PE=1 SV=1
sp|A0A2J8C362|CUTI1_VERDA	1.79e-21	11	241	6	236	Cutinase 11 OS=Verticillium dahliae OX=27337 GN=VD0003_g7577 PE=1 SV=1
sp|P9WP42|CULP1_MYCTO	2.44e-11	34	187	38	182	Carboxylesterase Culp1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT2037 PE=3 SV=1
sp|P63880|CULP1_MYCBO	2.44e-11	34	187	38	182	Carboxylesterase Culp1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB2006C PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000252	0.999725	CS pos: 17-18. Pr: 0.9078

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00109531-p1.