CAZyme Information: mRNA_M_BR32_EuGene_00109281-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00109281-p1
• CAZy Family: GH47
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
283		31103.65	5.0279

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00015:758327-759567(-)

Full Sequence      

MRVLSLGVLVSLLSSSVSAWNAPTYSDLRLVWQDAFAGTLGSAPDAGRWNYITNINVNNE
LQRYTTDSRNRQLSGGETLQIVPWHTNNEWTSGRIESKYTFTPAYGTVTVGEARIRFGDN
PISQKKGIWPAFWLLGDSLRSGTPWPQCGEIDILETVNGALTGYGTVHCDVYPGGICNEP
SGLAGTTGIPDQGWHTWRVQFDRRAGSWRDETITWFLDGQQFSQLNGARIGNEGVWNSLC
HSPLYFILNLAVGGTFPGNPDGNTLDGYGSMMEVGYVAHYVGI

Enzyme Prediction     

EC	3.2.1.6:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	32	280	2.6e-54	0.9956521739130435

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185691	GH16_Strep_laminarinase_like	1.60e-127	30	281	4	259	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
185693	GH16_laminarinase_like	9.90e-48	32	280	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185683	Glyco_hydrolase_16	1.47e-17	41	280	5	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185694	GH16_CCF	7.40e-12	30	263	1	288	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.
395585	Glyco_hydro_16	1.36e-11	89	220	19	123	Glycosyl hydrolases family 16.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ65235.1|GH16_3	5.22e-219	1	283	63	345
QKD49357.1|GH16_3	1.20e-141	8	280	9	284
CCT67692.1|GH16_3	1.20e-141	13	280	13	284
QGI94595.1|GH16_3	1.39e-140	13	280	13	284
QGI63713.1|GH16_3	1.39e-140	13	280	13	284

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7EO3_A	1.47e-47	21	283	3	277	Chain A, 1,3-beta-glucanase [Actinomycetia bacterium]
3ATG_A	2.41e-45	30	280	5	238	endo-1,3-beta-glucanase from Cellulosimicrobium cellulans [Cellulosimicrobium cellulans]
2HYK_A	7.33e-41	24	280	1	242	The crystal structure of an endo-beta-1,3-glucanase from alkaliphilic Nocardiopsis sp.strain F96 [Nocardiopsis sp. F96]
3DGT_A	8.23e-38	31	277	12	271	The 1.5 A crystal structure of endo-1,3-beta-glucanase from Streptomyces sioyaensis [Streptomyces sioyaensis]
4CRQ_A	4.51e-30	27	280	2	230	Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CRQ_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CTE_A Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans],4CTE_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P23903|E13B_NIACI	2.54e-23	16	280	411	679	Glucan endo-1,3-beta-glucosidase A1 OS=Niallia circulans OX=1397 GN=glcA PE=1 SV=1
sp|O33680|EXSH_RHIME	1.65e-09	27	280	240	457	Endo-1,3-1,4-beta-glycanase ExsH OS=Rhizobium meliloti (strain 1021) OX=266834 GN=exsH PE=1 SV=1
sp|Q9Z3Q2|EGLC_RHIME	2.30e-08	80	280	292	457	Endo-1,3-1,4-beta-glycanase EglC OS=Rhizobium meliloti (strain 1021) OX=266834 GN=eglC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000224	0.999760	CS pos: 19-20. Pr: 0.9797

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00109281-p1.