CAZyme Information: mRNA_M_BR32_EuGene_00108411-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00108411-p1
• CAZy Family: GH45
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
356		36898.14	10.0056

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00015:524372-525729(-)

Full Sequence      

MRSFTVASAIFGGLLATSPVYGQQCKLQFDGRVPANFKPANFDTANNIFNPSNVLGKGLK
FSDVIELPTLAQQSIFDVAGKTKAVEVTIKYDRHPTPGILLLIALGELGRLAQNGFRRTE
LLIASNNGTDDATKGVKTLHFSIAKDLKKPLNLTHEYQLVFLEDNKFSTNQIVVKTGTID
GQANTNPDTLNVFGNVASSPPKLLFSTPFGADGFHNFAMTLDFTKNTTQVFFSKGNEPLK
AVSKAEPNDVSGGGQLHFGCLKKGVGKVKDVVREGIQEPNINEGVIYGGIFMEDSANGCI
SLSAAAGAKAGAVGAGAVAGAGAGGAVAKAGAKVAGAAVKKGVAAAKAAKAAKAAN

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00108411-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH131	29	299	1.3e-71	0.9686274509803922

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408085	GH131_N	5.77e-77	27	298	1	251	Glycoside hydrolase 131 catalytic N-terminal domain. This is the N-terminal domain found in glycoside hydrolase family 131 (GH131A) protein observed in Coprinopsis cinerea. GH131A exhibits bifunctional exo-beta-1,3-/-1,6- and endo-beta-1,4 activity toward beta-glucan. This domain is catalytic in nature though the catalytic mechanism of C. cinerea GH131A is different from that of typical glycosidases that use a pair of carboxylic acid residues as the catalytic residues. In the case of GH131A, Glu98 and His218 may form a catalytic dyad and Glu98 may activate His218 during catalysis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ65172.1|GH131	7.46e-198	1	356	1	350
UQC91294.1|GH131	8.47e-96	16	303	90	364
AEO64872.1|GH131	2.18e-91	14	310	13	281
UQC90347.1|GH131	4.58e-89	2	303	5	284
VBB76803.1|GH131	3.58e-86	14	302	8	274

PDB Hits     

mRNA_M_BR32_EuGene_00108411-p1 has no PDB hit.

Swiss-Prot Hits     

mRNA_M_BR32_EuGene_00108411-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000304	0.999664	CS pos: 22-23. Pr: 0.9785

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00108411-p1.