CAZyme Information: mRNA_M_BR32_EuGene_00106001-p1

Basic Information

• Species: Pyricularia oryzae
• Lineage: Ascomycota; Sordariomycetes; ; Pyriculariaceae; Pyricularia; Pyricularia oryzae
• CAZyme ID: mRNA_M_BR32_EuGene_00106001-p1
• CAZy Family: GH43
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
677	BR32_scaffold00014|CGC2	75928.39	7.3021

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PoryzaeBR32	14781	N/A	432	14349

• Gene Location: location=BR32_scaffold00014:862865-864898(-)

Full Sequence      

MALMISGISLYAHRLATRGHDAPWEHMDWTTSMLFPTVMIISGGMLIRWDRDFRPQPRSS
STDGIIHRALIFGYVILAGSVLCSTVLRAPDESTIHDVPGLGTIISAAYAESERWQAHAG
SSKTLEEAVRTYRQRQGIPPPPNFDKWYEFARAKDSVIIDDFSQIESDLLPFWGMEPSAI
RDMTGQLLQYPKASMGGLRIHNGEIKLSPHIPGTHLWMVMGLADIIRPFSQWLPDMDLAI
NLDDECRAAVPFEDRAALQAEAGITRSRLGKVGAGDLIASFNSSHASTSKWSNRFMAKDG
MKDKAILPPFFEDYHKKPIYRTLVAPTCPPESPARNWRWWNKRDTCLACAAPHTSLSMEG
RVVSNWTGAQDVCHQPDMAHLDGFIFSPAAMITTRKMMPIFSQAKVTGFVDILMPSPWNF
HSKTPYKESADMSWDKKQNTVFWRGSATDGFAAAGSWTSFLRARFVDGADSIAEQMGPSA
ANSGVGLNVSFVGNFPRCEGPDCYAEAQHFYENRRSPLMIEGVDEQNAKEPAENKKSLGA
SVAFEEHFKFRHLADLDGAGFSGRFLPFMQSKSLVYRAGLFRTWFDERVHPWRHYVPLDL
RIGMGTDAWYSVAAFFGGRRGSHLGEKIALEGREWAEKATRPADMQVYMFRLLLEWGRIV
DDRRETLGYFGPSRSGG

Enzyme Prediction     

No EC number prediction in mRNA_M_BR32_EuGene_00106001-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	376	660	1.1e-74	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	1.10e-10	397	658	30	251	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	5.79e-04	399	658	108	321	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ53361.1|GT90	0.0	1	677	371	1047
QYT00402.1|GT90	2.38e-188	71	669	379	972
UKZ95698.1|GT90	2.27e-187	56	669	130	740
UKZ95697.1|GT90	6.13e-186	56	669	237	847
UKZ81405.1|GT90	2.62e-185	73	669	113	704

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	2.53e-09	513	672	232	394	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	6.42e-28	122	666	173	662	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q8T045|RUMI_DROME	7.65e-09	513	674	244	408	O-glucosyltransferase rumi OS=Drosophila melanogaster OX=7227 GN=rumi PE=1 SV=1
sp|B0X1Q4|RUMI_CULQU	2.30e-08	394	660	159	389	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998959	0.001058

TMHMM  Annotations     

There is no transmembrane helices in mRNA_M_BR32_EuGene_00106001-p1.